Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Apolipoprotein A-I/APOA1

Source: E.coli. MW :28.96kD. Recombinant Human Apolipoprotein A-I is produced by our E.coli expression system and the target gene encoding Arg19-Gln267 is expressed. Apolipoprotein A1 (APOA1) is a secreted protein which belongs to the Apolipoprotein A1/A4/E family. APOA1 is the major protein component of high density lipoprotein (HDL) in plasma. APOA1 plays a critical role in various biological processes, such as Cholesterol metabolism, Lipid metabolism and transport, Steroid metabolism. APOA1 promotes cholesterol efflux from tissues to the liver and thus helps to clear cholesterol from arteries. Defects in this gene resulted in HDL deficiencies, including Tangier disease (TGD), systemic non-neuropathic amyloidosis, premature coronary artery disease, hepatosplenomegaly and progressive muscle wasting and weakness. In addition, ApoA-I is implicated in the anti-endotoxin function of HDL via interaction with lipopolysaccharide or endotoxin.

Product Specifications

Gene Name

APOA1

Gene ID

335

UniProt

P02647

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

RHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Alogliptin Namino-[2- (2-hydroxyethylcarbamoyl) benzamide]
441233-01 10 mg

Alogliptin Namino-[2- (2-hydroxyethylcarbamoyl) benzamide]

Ask
View Details
Alogliptin Namino-[2- (2-hydroxyethylcarbamoyl) benzamide]
441233-02 25 mg

Alogliptin Namino-[2- (2-hydroxyethylcarbamoyl) benzamide]

Ask
View Details
Rat Monoclonal PXMP4 Antibody (7S41) [PE]
NBP2-21987PE 0.1 mL

Rat Monoclonal PXMP4 Antibody (7S41) [PE]

Ask
View Details
CDC45L (CDC45) (NM_003504) Human Mass Spec Standard
PH302442 10 µg

CDC45L (CDC45) (NM_003504) Human Mass Spec Standard

Ask
View Details
Recombinant Shigella flexneri serotype 5b Protein AaeX (aaeX)
MBS7007027-01 0.02 mg

Recombinant Shigella flexneri serotype 5b Protein AaeX (aaeX)

Ask
View Details
Recombinant Shigella flexneri serotype 5b Protein AaeX (aaeX)
MBS7007027-02 0.1 mg

Recombinant Shigella flexneri serotype 5b Protein AaeX (aaeX)

Ask
View Details