Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Coronin-6/CORO6 (N-6His)

Source: E.coli. MW :28.3kD. Recombinant Human Coronin-6 is produced by our E.coli expression system and the target gene encoding Met1-Asp237 is expressed with a 6His tag at the N-terminus. Coronin 6, a newly identified member of the coronin family, is highly enriched at adult NMJs and regulates AChR clustering via modulating the interaction between receptors and the actin cytoskeletal network. Coronins are a family of conserved actin-binding proteins originally identified in the actin-rich structure of the amoeba Dictyostelium discoideum . To date, seven members of coronins have been identified in mammals, and most exhibit tissue-specific distribution patterns. Coronin 6 is prominently expressed in adult muscle and enriched at the NMJ. Studies with cultured myotubes reveal that Coronin 6 regulates both agrin- and laminin-induced AChR clustering and is important for anchoring AChRs onto the actin cytoskeleton. Also, both the C-terminal region and a conserved Arg29 residue at the N terminus of Coronin 6 are essential for its actin-binding activity and stabilization of AChR–cytoskeleton linkage. Importantly, in vivo knockdown of Coronin 6 in mouse skeletal muscle fibers leads to destabilization of AChR clusters, which demonstrates that Coronin 6 is a critical regulator of AChR clustering at the postsynaptic region of the NMJs through modulating the receptor-anchored actin cytoskeleton. The human Coronin 6 has five isoforms produced by alternative splicing, and tissue-specific expression of these isoforms are unclear.

Product Specifications

Gene Name

CORO6

Gene ID

84940

UniProt

Q6QEF8

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MNHKVHHHHHHMPSPWGWFAVTACGAQRNNFEEPVALQEMDTSNGVLLPFYDPDSSIVYLCGKGDSSIRYFEITDEPPFVHYLNTFSSKEPQRGMGFMPKRGLDVSKCEIARFYKLHERKCEPIIMTVPRKSDLFQDDLYPDTPGPEPALEADEWLSGQDAEPVLISLRDGYVPPKHRELRVTKRNILDVRPPSGPRRSQSASDAPLSQHTLETLLEEIKALRERVQAQEQRITALENMLCELVDGTD
More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Bordetella pertussis 7-cyano-7-deazaguanine synthase (queC)
MBS1364407-01 0.02 mg (E-Coli)

Recombinant Bordetella pertussis 7-cyano-7-deazaguanine synthase (queC)

Sign In for Pricing
View Details
Recombinant Bordetella pertussis 7-cyano-7-deazaguanine synthase (queC)
MBS1364407-02 0.1 mg (E-Coli)

Recombinant Bordetella pertussis 7-cyano-7-deazaguanine synthase (queC)

Sign In for Pricing
View Details
Recombinant Bordetella pertussis 7-cyano-7-deazaguanine synthase (queC)
MBS1364407-03 0.02 mg (Yeast)

Recombinant Bordetella pertussis 7-cyano-7-deazaguanine synthase (queC)

Sign In for Pricing
View Details
Recombinant Bordetella pertussis 7-cyano-7-deazaguanine synthase (queC)
MBS1364407-04 0.1 mg (Yeast)

Recombinant Bordetella pertussis 7-cyano-7-deazaguanine synthase (queC)

Sign In for Pricing
View Details
Recombinant Bordetella pertussis 7-cyano-7-deazaguanine synthase (queC)
MBS1364407-05 0.02 mg (Baculovirus)

Recombinant Bordetella pertussis 7-cyano-7-deazaguanine synthase (queC)

Sign In for Pricing
View Details
Recombinant Bordetella pertussis 7-cyano-7-deazaguanine synthase (queC)
MBS1364407-06 0.02 mg (Mammalian-Cell)

Recombinant Bordetella pertussis 7-cyano-7-deazaguanine synthase (queC)

Sign In for Pricing
View Details