Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-4/IL-4

Source: E.coli. MW :13.4kD. Recombinant Mouse Interleukin-4 is produced by our E.coli expression system and the target gene encoding His23-Ser140 is expressed. Mouse Interleukin-4 (IL-4) is a monomeric, Th2 cytokine that shows pleiotropic effects during immune responses. It is a glycosylated polypeptide that contains three intrachain disulfide bridges and adopts a bundled four a­helix structure. IL­4 exerts its effects through two receptor complexes, Participates in at least several B-cell activation processes as well as of other cell types. IL­4 is primarily expressed by Th2­biased CD4+T cells, mast cells, basophils, and eosinophils. It promotes cell proliferation, survival, and immunoglobulin class switch to IgG1 and IgE in mouse B cells, acquisition of the Th2 phenotype by naà ̄ve CD4+T cells, priming and chemotaxis of mast cells, eosinophils, and basophils, and the proliferation and activation of epithelial cells. IL­4 plays a dominant role in the development of allergic inflammation and asthma. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes.

Product Specifications

Gene Name

Il4

Gene ID

16189

UniProt

P07750

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

GCC1 Human shRNA Plasmid Kit (Locus ID 79571)
TR304381 1 Kit

GCC1 Human shRNA Plasmid Kit (Locus ID 79571)

Ask
View Details
Rat Nucleus Pulposus Cells
RPC-1014 5x 10^5

Rat Nucleus Pulposus Cells

Ask
View Details
Dhrs7b (NM_001172112) Mouse Tagged Lenti ORF Clone
MR224621L4 10 µg

Dhrs7b (NM_001172112) Mouse Tagged Lenti ORF Clone

Ask
View Details
Anti-Human CD276 Antibody (Mab 8H9), PerCP
MBS1584804-01 50 Tests

Anti-Human CD276 Antibody (Mab 8H9), PerCP

Ask
View Details
Anti-Human CD276 Antibody (Mab 8H9), PerCP
MBS1584804-02 100 Tests

Anti-Human CD276 Antibody (Mab 8H9), PerCP

Ask
View Details
Anti-Human CD276 Antibody (Mab 8H9), PerCP
MBS1584804-03 5x 100 Tests

Anti-Human CD276 Antibody (Mab 8H9), PerCP

Ask
View Details