Recombinant Mouse Interleukin-16/IL-16
Source: E.coli. MW :14.5kD. Recombinant Mouse Interleukin-16 is produced by our E.coli expression system and the target gene encoding Ser1205-Ser1322 is expressed with a 6His tag at the N-terminus. Mouse interleukin-16 (IL-16) is a single chain non-glycosylated polypeptide. IL-16 is widely expressed in human tissues including spleen, thymus, lymph nodes, peripheral leukocytes, bone marrow and cerebellum. IL-16 plays an important role instimulating a migratory response in CD4+ lymphocytes, monocytes, and eosinophils, inducing T-lymphocyte expression of interleukin 2 receptor.It was originally identified as a CD8+ T cell-derived chemoattractant for CD4+ cells. In addition to its chemotactic properties, IL-16 has also been shown to suppress HIV-1 replication in vitro and appears to be involved in transcriptional regulation of SKP2 and is probably part of a transcriptional repression complex on the core promoter of the SKP2 gene. It may act as a scaffold for GABPB1 (the DNA-binding subunit the GABP transcription factor complex) and HDAC3 thus maintaining transcriptional repression and blocking cell cycle progression in resting T-cells.
Product Specifications
Gene Name
Il16
Gene ID
16170
UniProt
O54824
Components
Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NaCl, pH 8.0.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
MGSSHHHHHHSSGLVPRGSHMSAASASAASDISVESKEATVCTVTLEKTSAGLGFSLEGGKGSLHGDKPLTINRIFKGTEQGEMVQPGDEILQLAGTAVQGLTRFEAWNVIKALPDGPVTIVIRRTSLQCKQTTASADS
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items