Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-16/IL-16

Source: E.coli. MW :14.5kD. Recombinant Mouse Interleukin-16 is produced by our E.coli expression system and the target gene encoding Ser1205-Ser1322 is expressed with a 6His tag at the N-terminus. Mouse interleukin-16 (IL-16) is a single chain non-glycosylated polypeptide. IL-16 is widely expressed in human tissues including spleen, thymus, lymph nodes, peripheral leukocytes, bone marrow and cerebellum. IL-16 plays an important role instimulating a migratory response in CD4+ lymphocytes, monocytes, and eosinophils, inducing T-lymphocyte expression of interleukin 2 receptor.It was originally identified as a CD8+ T cell-derived chemoattractant for CD4+ cells. In addition to its chemotactic properties, IL-16 has also been shown to suppress HIV-1 replication in vitro and appears to be involved in transcriptional regulation of SKP2 and is probably part of a transcriptional repression complex on the core promoter of the SKP2 gene. It may act as a scaffold for GABPB1 (the DNA-binding subunit the GABP transcription factor complex) and HDAC3 thus maintaining transcriptional repression and blocking cell cycle progression in resting T-cells.

Product Specifications

Gene Name

Il16

Gene ID

16170

UniProt

O54824

Components

Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NaCl, pH 8.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMSAASASAASDISVESKEATVCTVTLEKTSAGLGFSLEGGKGSLHGDKPLTINRIFKGTEQGEMVQPGDEILQLAGTAVQGLTRFEAWNVIKALPDGPVTIVIRRTSLQCKQTTASADS

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human PINX1 Pre-designed siRNA Set A
SI012202A 1 Each

Human PINX1 Pre-designed siRNA Set A

Ask
View Details
Bovine Lysozyme (LZM) ELISA Kit
YP-W77363-01 48 Tests

Bovine Lysozyme (LZM) ELISA Kit

Ask
View Details
Bovine Lysozyme (LZM) ELISA Kit
YP-W77363-02 96 Tests

Bovine Lysozyme (LZM) ELISA Kit

Ask
View Details
Troponin T (Cardiac) (HRP)
MBS6262666-01 0.1 mL

Troponin T (Cardiac) (HRP)

Ask
View Details
Troponin T (Cardiac) (HRP)
MBS6262666-02 5x 0.1 mL

Troponin T (Cardiac) (HRP)

Ask
View Details
Human Cdx2 (Caudal Type Homeobox Transcription Factor 2) ELISA Kit
FY-EH2053 96 Well

Human Cdx2 (Caudal Type Homeobox Transcription Factor 2) ELISA Kit

Ask
View Details