Recombinant Mouse Interleukin-21/IL-21
Source: E.coli. MW :14.4kD. Recombinant Mouse Interleukin-21 is produced by our E.coli expression system and the target gene encoding Pro25-Ser146 is expressed. Interleukin-21 also known as IL-21 is a protein that in mouse is encoded by the IL21 gene, belongs to the IL-15/IL-21 family. Interleukin-21 is a cytokine that has potent regulatory effects on cells of the immune system, including natural killer (NK) cells and cytotoxic T cells that can destroy virally infected or cancerous cells. This cytokine induces cell division/proliferation in its target cells.
Product Specifications
Gene Name
Il21
Gene ID
60505
UniProt
Q9ES17
Components
Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
MPDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items