Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein N-terminal Glutamine Amidohydrolase/NTAQ1

Source: E.coli. MW :49.8kD. Recombinant Human NTAQ1 is produced by our E.coli expression system and the target gene encoding Met1-Cys205 is expressed with a GST tag at the N-terminus. Human protein N-terminal glutamine amidohydrolase (WDYHV1) is an enzyme that in humans is encoded by the WDYHV1 gene, belongs to the NTAQ1 family.WDYHV1 mediates the side-chain deamidation of N-terminal glutamine residues to glutamate, which is an important step in N-end rule pathway of protein degradation. Conversion of the resulting N-terminal glutamine to glutamate renders the protein susceptible to arginylation, polyubiquitination and degradation as specified by the N-end rule. However, it does not act on substrates with internal or C-terminal glutamine andnon-glutamine residues in any position. With the exception of proline, all tested second-position residues on substrate peptides do not greatly influence the activity. In contrast, a proline at position 2, virtually abolishes deamidation of N-terminal glutamine.

Product Specifications

Gene Name

WDYHV1

Gene ID

55093

UniProt

Q96HA8

Components

Supplied as a 0.2 μm filtered solution of PBS,100mM GSH,1% TritonX-100,15% glycerol, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSMEGNGPAAVHYQPASPPRDACVYSSCYCEENVWKLCEYIKNHDQYPLEECYAVFISNERKMIPIWKQQARPGDGPVIWDYHVVLLHVSSGGQSFIYDLDTVLPFPCLFDTYVEDAIKSDDDIHPQFRRKFRVICADSYLKNFASDRSHMKDSSGNWREPPPPYPCIETGDSKMNLNDFISMDPKVGWGAVYTLSEFTHRFGSKNC
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

MTHFD2L Antibody
MBS1493833-01 0.05 mg

MTHFD2L Antibody

Ask
View Details
MTHFD2L Antibody
MBS1493833-02 0.1 mg

MTHFD2L Antibody

Ask
View Details
MTHFD2L Antibody
MBS1493833-03 5x 0.1 mg

MTHFD2L Antibody

Ask
View Details
Rabbit Monoclonal Siglec-2/CD22 Antibody (BLCAM/8113R) - Azide and BSA Free
NBP3-20963 100 µg

Rabbit Monoclonal Siglec-2/CD22 Antibody (BLCAM/8113R) - Azide and BSA Free

Ask
View Details
APOL4, ID (E273) (Apolipoprotein L4, Apolipoprotein L-IV, ApoL-IV) (MaxLight 650)
MBS6463825-01 0.1 mL

APOL4, ID (E273) (Apolipoprotein L4, Apolipoprotein L-IV, ApoL-IV) (MaxLight 650)

Ask
View Details
APOL4, ID (E273) (Apolipoprotein L4, Apolipoprotein L-IV, ApoL-IV) (MaxLight 650)
MBS6463825-02 5x 0.1 mL

APOL4, ID (E273) (Apolipoprotein L4, Apolipoprotein L-IV, ApoL-IV) (MaxLight 650)

Ask
View Details