Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Biliverdin Reductase A/BVR A (C-6His)

Source: E.coli. MW :33.8kD. Recombinant Human Biliverdin reductase A is produced by our E.coli expression system and the target gene encoding Glu6-Ser294 is expressed with a 6His tag at the C-terminus. Human Biliverdin reductase A (BLVRA) is belonged to the Gfo/Idh/MocA family and Biliverdin reductase subfamily. BLVRA is an enzyme that in humans is encoded by the BLVRA gene. BLVRA plays an important role in reducing the gamma-methene bridge of the open tetrapyrrole, biliverdin IX alpha, to bilirubin with the concomitant oxidation of a NADH or NADPH cofactor. BLVRA acts on biliverdin by reducing its double-bond between the pyrrole rings into a single-bond. It accomplishes this using NADPH + H+ as an electron donor, forming bilirubin and NADP+ as products.

Product Specifications

Gene Name

BLVRA

Gene ID

644

UniProt

P53004

Components

Lyophilized from a 0.2 μm filtered solution of 4mM HCl.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKVSHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLFGELSLVSATLEERKEDQYMKMTVCLETEKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLENVPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLGLAEEIQKYCCSLEHHHHHH
More Discoveries

Explore Other Products

Browse additional items from our catalog

P300 (phospho Ser89) Polyclonal Antibody
ABP54122-01 30 µL

P300 (phospho Ser89) Polyclonal Antibody

Sign In for Pricing
View Details
P300 (phospho Ser89) Polyclonal Antibody
ABP54122-02 100 µL

P300 (phospho Ser89) Polyclonal Antibody

Sign In for Pricing
View Details
P300 (phospho Ser89) Polyclonal Antibody
ABP54122-03 200 µL

P300 (phospho Ser89) Polyclonal Antibody

Sign In for Pricing
View Details
PDE9A (NM_001001575) Human Tagged ORF Clone Lentiviral Particle
RC217025L3V 200 µL

PDE9A (NM_001001575) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
TMPRSS6 sgRNA CRISPR Lentivector set (Human)
K2410601 3x 1.0 µg

TMPRSS6 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Adhesion Molecule With Ig Like Domain 1 (AMIGO1) Antibody
abx308339-01 20 µg

Adhesion Molecule With Ig Like Domain 1 (AMIGO1) Antibody

Sign In for Pricing
View Details