Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Biliverdin Reductase A/BVR A (C-6His)

Source: E.coli. MW :33.8kD. Recombinant Human Biliverdin reductase A is produced by our E.coli expression system and the target gene encoding Glu6-Ser294 is expressed with a 6His tag at the C-terminus. Human Biliverdin reductase A (BLVRA) is belonged to the Gfo/Idh/MocA family and Biliverdin reductase subfamily. BLVRA is an enzyme that in humans is encoded by the BLVRA gene. BLVRA plays an important role in reducing the gamma-methene bridge of the open tetrapyrrole, biliverdin IX alpha, to bilirubin with the concomitant oxidation of a NADH or NADPH cofactor. BLVRA acts on biliverdin by reducing its double-bond between the pyrrole rings into a single-bond. It accomplishes this using NADPH + H+ as an electron donor, forming bilirubin and NADP+ as products.

Product Specifications

Gene Name

BLVRA

Gene ID

644

UniProt

P53004

Components

Lyophilized from a 0.2 μm filtered solution of 4mM HCl.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKVSHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLFGELSLVSATLEERKEDQYMKMTVCLETEKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLENVPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLGLAEEIQKYCCSLEHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

MFRP Peptide - middle region
MBS3230720-01 0.1 mg

MFRP Peptide - middle region

Ask
View Details
MFRP Peptide - middle region
MBS3230720-02 5x 0.1 mg

MFRP Peptide - middle region

Ask
View Details
Sotirimod 1mg
A19244-1 1 mg

Sotirimod 1mg

Ask
View Details
Research Grade Anti-SARS-CoV-2 RBD antibody (VHH-72-Fc)
RVV00305 100 μg

Research Grade Anti-SARS-CoV-2 RBD antibody (VHH-72-Fc)

Ask
View Details
MAPK12 Protein (N-GST & His, Human)
P526623 100 µg

MAPK12 Protein (N-GST & His, Human)

Ask
View Details
RANBP6 Protein Lysate (Rat) with C-HA Tag
38480036 100 µg

RANBP6 Protein Lysate (Rat) with C-HA Tag

Ask
View Details