Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Biliverdin Reductase A/BVR A (C-6His)

Source: E.coli. MW :33.8kD. Recombinant Human Biliverdin reductase A is produced by our E.coli expression system and the target gene encoding Glu6-Ser294 is expressed with a 6His tag at the C-terminus. Human Biliverdin reductase A (BLVRA) is belonged to the Gfo/Idh/MocA family and Biliverdin reductase subfamily. BLVRA is an enzyme that in humans is encoded by the BLVRA gene. BLVRA plays an important role in reducing the gamma-methene bridge of the open tetrapyrrole, biliverdin IX alpha, to bilirubin with the concomitant oxidation of a NADH or NADPH cofactor. BLVRA acts on biliverdin by reducing its double-bond between the pyrrole rings into a single-bond. It accomplishes this using NADPH + H+ as an electron donor, forming bilirubin and NADP+ as products.

Product Specifications

Gene Name

BLVRA

Gene ID

644

UniProt

P53004

Components

Lyophilized from a 0.2 μm filtered solution of 4mM HCl.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKVSHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLFGELSLVSATLEERKEDQYMKMTVCLETEKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLENVPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLGLAEEIQKYCCSLEHHHHHH
More Discoveries

Explore Other Products

Browse additional items from our catalog

LRP3 shRNA Plasmid (m)
sc-149048-SH 20 µg

LRP3 shRNA Plasmid (m)

Sign In for Pricing
View Details
Guinea pig Cytidine deaminase (CDA) ELISA Kit
MBS7218528-01 48 Well

Guinea pig Cytidine deaminase (CDA) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Cytidine deaminase (CDA) ELISA Kit
MBS7218528-02 96 Well

Guinea pig Cytidine deaminase (CDA) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Cytidine deaminase (CDA) ELISA Kit
MBS7218528-03 5x 96 Well

Guinea pig Cytidine deaminase (CDA) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Cytidine deaminase (CDA) ELISA Kit
MBS7218528-04 10x 96 Well

Guinea pig Cytidine deaminase (CDA) ELISA Kit

Sign In for Pricing
View Details
SAR-020106 10mg
A22371-10 10 mg

SAR-020106 10mg

Sign In for Pricing
View Details