Recombinant Human Sulfotransferase/SULT1C4/SULT1C2
Source: E.coli. MW :14.1kD. Recombinant Human Sulfotransferase 1C4 is produced by our E.coli expression system and the target gene encoding Met1-Lys102 is expressed with a 6His tag at the N-terminus. Human Sulfotransferase (SULT1C4) is an enzyme that in humans is encoded by the SULT1C4 gene, belongs to the sulfotransferase 1 family. SULT1C4 is expressed at high levels in fetal lung and kidney and at low levels in fetal heart, adult kidney, ovary and spinal chord. Sulfotransferase utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of drugs, xenobiotic compounds, hormones, and neurotransmitters. It shows activity towards p-nitrophenol and N-hydroxy-2-acetylamino-fluorene (N-OH-2AAF) . SULT1C4 plays an important role incatalyzing the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds.
Product Specifications
Gene Name
SULT1C4
Gene ID
27233
UniProt
Q6PD90
Components
Lyophilized from a 0.2 μm filtered solution of 4mM HCl.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
MGSSHHHHHHSSGLVPRGSHMMALHDMEDFTFDGTKRLSVNYVKGILQPTDTCDIWDKIWNFQAKPDDLLISTYPKAGTTWTQEIVELIQNEGDVEKSKRAPTHQRFPFLEMKIPSLGSGEYK
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog