Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sulfotransferase/SULT1C4/SULT1C2

Source: E.coli. MW :14.1kD. Recombinant Human Sulfotransferase 1C4 is produced by our E.coli expression system and the target gene encoding Met1-Lys102 is expressed with a 6His tag at the N-terminus. Human Sulfotransferase (SULT1C4) is an enzyme that in humans is encoded by the SULT1C4 gene, belongs to the sulfotransferase 1 family. SULT1C4 is expressed at high levels in fetal lung and kidney and at low levels in fetal heart, adult kidney, ovary and spinal chord. Sulfotransferase utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of drugs, xenobiotic compounds, hormones, and neurotransmitters. It shows activity towards p-nitrophenol and N-hydroxy-2-acetylamino-fluorene (N-OH-2AAF) . SULT1C4 plays an important role incatalyzing the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds.

Product Specifications

Gene Name

SULT1C4

Gene ID

27233

UniProt

Q6PD90

Components

Lyophilized from a 0.2 μm filtered solution of 4mM HCl.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMMALHDMEDFTFDGTKRLSVNYVKGILQPTDTCDIWDKIWNFQAKPDDLLISTYPKAGTTWTQEIVELIQNEGDVEKSKRAPTHQRFPFLEMKIPSLGSGEYK

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal GATA-3 Antibody (GATA3/2445) [Alexa Fluor 488]
NBP3-08425AF488 100 µL

Mouse Monoclonal GATA-3 Antibody (GATA3/2445) [Alexa Fluor 488]

Ask
View Details
Dual Range Voltmeter MR-100
1091650/15 1 Each

Dual Range Voltmeter MR-100

Ask
View Details
Olfr1104 Mouse qPCR Primer Pair (NM_146767)
MP209343 200 Reactions

Olfr1104 Mouse qPCR Primer Pair (NM_146767)

Ask
View Details
Mouse Monoclonal ABCG2/CD338 Antibody (MM0047-2J39) [Allophycocyanin]
NB110-93511APC 0.1 mL

Mouse Monoclonal ABCG2/CD338 Antibody (MM0047-2J39) [Allophycocyanin]

Ask
View Details
Ampicillin/Cloxacillin
ABDAX10C 5 Carts

Ampicillin/Cloxacillin

Ask
View Details
Anti-Sulf-1 Antibody
CQA6094-01 30 µL

Anti-Sulf-1 Antibody

Ask
View Details