Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sulfotransferase/SULT1C4/SULT1C2

Source: E.coli. MW :14.1kD. Recombinant Human Sulfotransferase 1C4 is produced by our E.coli expression system and the target gene encoding Met1-Lys102 is expressed with a 6His tag at the N-terminus. Human Sulfotransferase (SULT1C4) is an enzyme that in humans is encoded by the SULT1C4 gene, belongs to the sulfotransferase 1 family. SULT1C4 is expressed at high levels in fetal lung and kidney and at low levels in fetal heart, adult kidney, ovary and spinal chord. Sulfotransferase utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of drugs, xenobiotic compounds, hormones, and neurotransmitters. It shows activity towards p-nitrophenol and N-hydroxy-2-acetylamino-fluorene (N-OH-2AAF) . SULT1C4 plays an important role incatalyzing the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds.

Product Specifications

Gene Name

SULT1C4

Gene ID

27233

UniProt

Q6PD90

Components

Lyophilized from a 0.2 μm filtered solution of 4mM HCl.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMMALHDMEDFTFDGTKRLSVNYVKGILQPTDTCDIWDKIWNFQAKPDDLLISTYPKAGTTWTQEIVELIQNEGDVEKSKRAPTHQRFPFLEMKIPSLGSGEYK

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Pseudomonas Agar Base (CN Agar)
M085I-100G 100 g

Pseudomonas Agar Base (CN Agar)

Ask
View Details
Hepatitis B Virus preS1 (HBV preS1) (MaxLight 650)
226982-ML650 100 µL

Hepatitis B Virus preS1 (HBV preS1) (MaxLight 650)

Ask
View Details
Microscope Slides Superficial Placentation
4041900/6 1 Each

Microscope Slides Superficial Placentation

Ask
View Details
Recombinant Octamer Binding Transcription Factor 1 (OCT1)
SIPB145Mu01-01 10 µg

Recombinant Octamer Binding Transcription Factor 1 (OCT1)

Ask
View Details
Recombinant Octamer Binding Transcription Factor 1 (OCT1)
SIPB145Mu01-02 50 µg

Recombinant Octamer Binding Transcription Factor 1 (OCT1)

Ask
View Details
Recombinant Octamer Binding Transcription Factor 1 (OCT1)
SIPB145Mu01-03 200 µg

Recombinant Octamer Binding Transcription Factor 1 (OCT1)

Ask
View Details