Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vibrio cholerae Toxin B

Source: E.coli. MW :11.8kD. Recombinant Vibriocholerae Toxin B is produced by our E.coli expression system and the target gene encoding Thr22-Asn124 is expressed. Cholera toxin is protein complex secreted by the bacterium Vibrio cholerae. It is responsible for the massive, watery diarrhea characteristic of cholera infection. Cholera enterotoxin subunit B (CTXB) pentameric ring directs the A subunit to its target by binding to the GM1 gangliosides present on the surface of the intestinal epithelial cells. It can bind five GM1 gangliosides. It has no toxic activity by itself.

Product Specifications

Gene Name

CtxB

Gene ID

2613962

UniProt

P01556

Components

Lyophilized from a 0.2 μm filtered solution of 50mM Tris, 200uM NaCl, pH8.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MTPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

VZV gE Polyclonal Antibody, Cy5 Conjugated
bs-42275R-Cy5 100 µL

VZV gE Polyclonal Antibody, Cy5 Conjugated

Ask
View Details
N-6-Furfurylguanosine
MBS5825620 Inquire

N-6-Furfurylguanosine

Ask
View Details
CENPA Rabbit Polyclonal Antibody
TA311924 100 µL

CENPA Rabbit Polyclonal Antibody

Ask
View Details
Follicle Stimulating Hormone (FSH) (Biotin)
MBS6261270-01 0.1 mL

Follicle Stimulating Hormone (FSH) (Biotin)

Ask
View Details
Follicle Stimulating Hormone (FSH) (Biotin)
MBS6261270-02 5x 0.1 mL

Follicle Stimulating Hormone (FSH) (Biotin)

Ask
View Details
Anti-ELF5 antibody
STJ70205 100 µg

Anti-ELF5 antibody

Ask
View Details