Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse PDCD1/PD-1/CD279 (C-6His)

Source: Human Cells. MW :17.2kD. Recombinant Mouse Programmed Cell Death Protein 1 is produced by our Mammalian expression system and the target gene encoding Leu25-Gln167 is expressed with a 6His tag at the C-terminus. Programmed Death-1 (PD-1), firstly cloned from mouse T cell hybridoma 2B4.11, is one member of CD28/CTLA-4 superfamily. PD-1 belongs to type I transmembrane protein and acts as an important immunosuppressive molecule. The cytoplamsic tail of PD-1 contains two structural motifs, an immunoreceptor tyrosine-based inhibitory motif (ITIM) and an immunoreceptor tyrosine-based switch motif (ITSM) formed by two tyrosine residues which make the difference in PD-1 signal mediating. Mouse PD-1 is expressed in thymus and shares about 69% aa sequence identity with human PD-1. Recently, programmed death-1 (PD-1) with its ligands, programmed death ligand B7H1 (PD-L1) and B7DC (PD-L2), was found to regulate T-cell activation and tolerance, upon ligand binding, inhibiting T-cell effector functions in an antigen-specific manner. PD-1 gene knocked out mice would induce some autoimmune diseases, which suggests that PD-1 acts as a co-inhibitory molecule actively participating in maintaining peripheral tolerance. Thus, PD-1 may be a useful target for the immunologic therapy of carcinoma, infection, autoimmune diseases as well as organ transplantation.

Product Specifications

Gene Name

Pdcd1

Gene ID

18566

UniProt

Q02242

Components

Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NaCl, pH8.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

LEVPNGPWRSLTFYPAWLTVSEGANATFTCSLSNWSEDLMLNWNRLSPSNQTEKQAAFCNGLSQPVQDARFQIIQLPNRHDFHMNILDTRRNDSGIYLCGAISLHPKAKIEESPGAELVVTERILETSTRYPSPSPKPEGRFQVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

SART3 (NM_014706) Human Tagged Lenti ORF Clone
RC210837L2 10 µg

SART3 (NM_014706) Human Tagged Lenti ORF Clone

Ask
View Details
Mouse T-cell leukemia homeobox protein 1, Tlx1 ELISA KIT
ELI-17098m 96 Tests

Mouse T-cell leukemia homeobox protein 1, Tlx1 ELISA KIT

Ask
View Details
Porcine Neurofilament, Medium Polypeptide (NEFM) ELISA Kit
MBS9361605-01 48 Well

Porcine Neurofilament, Medium Polypeptide (NEFM) ELISA Kit

Ask
View Details
Porcine Neurofilament, Medium Polypeptide (NEFM) ELISA Kit
MBS9361605-02 96 Well

Porcine Neurofilament, Medium Polypeptide (NEFM) ELISA Kit

Ask
View Details
Porcine Neurofilament, Medium Polypeptide (NEFM) ELISA Kit
MBS9361605-03 5x 96 Well

Porcine Neurofilament, Medium Polypeptide (NEFM) ELISA Kit

Ask
View Details
Porcine Neurofilament, Medium Polypeptide (NEFM) ELISA Kit
MBS9361605-04 10x 96 Well

Porcine Neurofilament, Medium Polypeptide (NEFM) ELISA Kit

Ask
View Details