Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse PDCD1/PD-1/CD279 (C-6His)

Source: Human Cells. MW :17.2kD. Recombinant Mouse Programmed Cell Death Protein 1 is produced by our Mammalian expression system and the target gene encoding Leu25-Gln167 is expressed with a 6His tag at the C-terminus. Programmed Death-1 (PD-1), firstly cloned from mouse T cell hybridoma 2B4.11, is one member of CD28/CTLA-4 superfamily. PD-1 belongs to type I transmembrane protein and acts as an important immunosuppressive molecule. The cytoplamsic tail of PD-1 contains two structural motifs, an immunoreceptor tyrosine-based inhibitory motif (ITIM) and an immunoreceptor tyrosine-based switch motif (ITSM) formed by two tyrosine residues which make the difference in PD-1 signal mediating. Mouse PD-1 is expressed in thymus and shares about 69% aa sequence identity with human PD-1. Recently, programmed death-1 (PD-1) with its ligands, programmed death ligand B7H1 (PD-L1) and B7DC (PD-L2), was found to regulate T-cell activation and tolerance, upon ligand binding, inhibiting T-cell effector functions in an antigen-specific manner. PD-1 gene knocked out mice would induce some autoimmune diseases, which suggests that PD-1 acts as a co-inhibitory molecule actively participating in maintaining peripheral tolerance. Thus, PD-1 may be a useful target for the immunologic therapy of carcinoma, infection, autoimmune diseases as well as organ transplantation.

Product Specifications

Gene Name

Pdcd1

Gene ID

18566

UniProt

Q02242

Components

Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NaCl, pH8.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

LEVPNGPWRSLTFYPAWLTVSEGANATFTCSLSNWSEDLMLNWNRLSPSNQTEKQAAFCNGLSQPVQDARFQIIQLPNRHDFHMNILDTRRNDSGIYLCGAISLHPKAKIEESPGAELVVTERILETSTRYPSPSPKPEGRFQVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal ILT5/CD85a/LILRB3 Antibody (MM0413-9S32) [PE]
NBP2-11729PE 0.1 mL

Mouse Monoclonal ILT5/CD85a/LILRB3 Antibody (MM0413-9S32) [PE]

Ask
View Details
Calpastatin (CAST) (NM_173061) Human Tagged ORF Clone
RG222278 10 µg

Calpastatin (CAST) (NM_173061) Human Tagged ORF Clone

Ask
View Details
Lentiviral human ADCY1 sgRNA gene knockout kit - Lentiviral human ADCY1 sgRNA gene knockout kit (100)
GTR15389575 1 Vial

Lentiviral human ADCY1 sgRNA gene knockout kit - Lentiviral human ADCY1 sgRNA gene knockout kit (100)

Ask
View Details
LRP1 Protein, Human, Recombinant (Cluster II, His)
MF-0108289-01 5 µg

LRP1 Protein, Human, Recombinant (Cluster II, His)

Ask
View Details
LRP1 Protein, Human, Recombinant (Cluster II, His)
MF-0108289-02 10 µg

LRP1 Protein, Human, Recombinant (Cluster II, His)

Ask
View Details
LRP1 Protein, Human, Recombinant (Cluster II, His)
MF-0108289-03 20 µg

LRP1 Protein, Human, Recombinant (Cluster II, His)

Ask
View Details