Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat VEGF-A/VEGF164

Source: P.Pichia. MW :19.2kD. Recombinant Rat Vascular Endothelial Growth Factor A is produced by our Yeast expression system and the target gene encoding Ala27-Arg190 is expressed. Vascular endothelial growth factor (VEGF/VEGF-A) is originally known as vascular permeability factor (VPF) . It belongs to the PDGF family with a cysteine-knot structure comprised of eight conserved cysteine residues, and reckoned as a potent mediator in the process of angiogenesis and vasculogenesis in either fetus or adult. VEGF is particularly expressed in supraoptic , paraventricular nuclei and the choroid plexus of the pituitary, and abundant in the corpus luteum of the ovary and in kidney glomeruli. The rat VEGF protein contains a putative 20 amino acids (aa) signal peptide, and alternative splicing of rat VEGF gene produces isoforms of 120, 144, 164 and 188 aa. Rat VEGF164 respectively displays 97% and 88% aa identity with that regions of mouse and human VEGF. VEGF can bind to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin, and play important roles in inducing endothelial cell proliferation, promoting cell migration, inhibiting apoptosis and inducing permeabilization of blood vessels.

Product Specifications

Gene Name

Vegfa

Gene ID

83785

UniProt

P16612

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

APTTEGEQKTHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNVTMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Human Sperm Mitochondria-Associated Cysteine-Rich Protein
32-4869-10 10 µg

Recombinant Human Sperm Mitochondria-Associated Cysteine-Rich Protein

Ask
View Details
Protein (C-His, Rat)
P516942 100 µg

Protein (C-His, Rat)

Ask
View Details
P27
MF-0127323-01 10 mg

P27

Ask
View Details
P27
MF-0127323-02 50 mg

P27

Ask
View Details
SART1 Polyclonal Antibody, APC Conjugated
bs-7874R-APC 100 µL

SART1 Polyclonal Antibody, APC Conjugated

Ask
View Details
SPTLC1 (NM_006415) Human Tagged Lenti ORF Clone
RC222985L2 10 µg

SPTLC1 (NM_006415) Human Tagged Lenti ORF Clone

Ask
View Details