Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse TRANCE/RANK L/TNFSF11 (C-6His)

Source: Human Cells. MW :28.5kD. Recombinant Mouse TNF-related Activation-induced Cytokine is produced by our Mammalian expression system and the target gene encoding Ala73-Asp316 is expressed with a 6His tag at the C-terminus. Mouse tumor necrosis factor ligand superfamily member 11 (Tnfsf11) is a member of the tumor necrosis factor (TNF) cytokine family. Tnfsf11 is widely expressed in cells including T cells and T cell rich organs, such as thymus and lymph nodes. This cytokine can bind to TNFRSF11B/OPG andTNFRSF11A/RANK. Tnfsf11 is involved in a number of fundamental biological processes such as acting as regulator of interactions between T-cells and dendritic cells, the regulation of the T-cell-dependent immune response and enhancing bone-resorption in humoral hypercalcemia of malignancy. It augments the ability of dendritic cells to stimulate naive T-cell proliferation.

Product Specifications

Gene Name

Tnfsf11

Gene ID

21943

UniProt

O35235

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

AQMDPNRISEDSTHCFYRILRLHENAGLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDIDVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CC148 rabbit pAb
UB-GEN-8627 100 µL

CC148 rabbit pAb

Ask
View Details
Guinea pig Coiled-coil domain-containing protein 69 (CCDC69) ELISA Kit
MBS7218406-01 48 Well

Guinea pig Coiled-coil domain-containing protein 69 (CCDC69) ELISA Kit

Ask
View Details
Guinea pig Coiled-coil domain-containing protein 69 (CCDC69) ELISA Kit
MBS7218406-02 96 Well

Guinea pig Coiled-coil domain-containing protein 69 (CCDC69) ELISA Kit

Ask
View Details
Guinea pig Coiled-coil domain-containing protein 69 (CCDC69) ELISA Kit
MBS7218406-03 5x 96 Well

Guinea pig Coiled-coil domain-containing protein 69 (CCDC69) ELISA Kit

Ask
View Details
Guinea pig Coiled-coil domain-containing protein 69 (CCDC69) ELISA Kit
MBS7218406-04 10x 96 Well

Guinea pig Coiled-coil domain-containing protein 69 (CCDC69) ELISA Kit

Ask
View Details
Tasp1 3'UTR Lenti-reporter-Luc Vector
46212084 1.0 µg

Tasp1 3'UTR Lenti-reporter-Luc Vector

Ask
View Details