Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse HVEM/TNFRSF14/TR2/CD270 (C-Fc)

Source: Human Cells. MW :45.6kD. Recombinant Mouse Herpesvirus Entry Mediator is produced by our Mammalian expression system and the target gene encoding Gln39-Val207 is expressed with a Fc tag at the C-terminus. Mouse Protein Tnfrsf14, is a type I transmembrane protein belonging to the TNF receptor superfamily. It is tumor necrosis factor receptor superfamily member 14 and expressed on the surface of T cells during the resting state. Interaction of HVEM with TNF family member LIGHT co-stimulates T cells and promotes inflammation. HVEM also triggers inhibitory signaling cascade in effector T (Teff) cells and regulatory T cells (Tregs) as a ligand of B and T lymphocyte attenuator. Tnfrsf14 is detected in peripheral blood T cells, B cells, monocytes and in various tissues enriched in lymphoid cells. It has demonstrated that HVEM Ig is able to exert a significant antiviral effect against HSV-1 infection in vivo.

Product Specifications

Gene Name

Tnfrsf14

Gene ID

230979

UniProt

Q80WM9

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

GYHVKQVCSEHTGTVCAPCPPQTYTAHANGLSKCLPCGVCDPDMGLLTWQECSSWKDTVCRCIPGYFCENQDGSHCSTCLQHTTCPPGQRVEKRGTHDQDTVCADCLTGTFSLGGTQEECLPWTNCSAFQQEVRRGTNSTDTTCSSQVVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Anti-beta-2-microglobulin (aa65-79) antibody
STJ72800 100 µg

Anti-beta-2-microglobulin (aa65-79) antibody

Ask
View Details
Recombinant Mouse CD339/JAG1 Protein, N-His
E55P6857 50 µg

Recombinant Mouse CD339/JAG1 Protein, N-His

Ask
View Details
DIAPH3 Knockout HAP1 Polyclonal Cells
ARG38752 1 Million

DIAPH3 Knockout HAP1 Polyclonal Cells

Ask
View Details
IL36B Antibody
A18192-50UG 50 µg

IL36B Antibody

Ask
View Details
Mouse IL-17 Quantikine HS ELISA Kit
MHS170 96 Tests

Mouse IL-17 Quantikine HS ELISA Kit

Ask
View Details
ENTPD5 (Ectonucleoside Triphosphate Diphosphohydrolase 5, NTPDase 5, CD39 Antigen-like 4, ER-UDPase, Guanosine-diphosphatase ENTPD5, GDPase ENTPD5, Nucleoside Diphosphatase, Uridine-diphosphatase ENTPD5, UDPase ENTPD5, CD39L4, PCPH) (MaxLight 650)
126352-ML650 100 µL

ENTPD5 (Ectonucleoside Triphosphate Diphosphohydrolase 5, NTPDase 5, CD39 Antigen-like 4, ER-UDPase, Guanosine-diphosphatase ENTPD5, GDPase ENTPD5, Nucleoside Diphosphatase, Uridine-diphosphatase ENTPD5, UDPase ENTPD5, CD39L4, PCPH) (MaxLight 650)

Ask
View Details