Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse HVEM/TNFRSF14/TR2/CD270 (C-Fc)

Source: Human Cells. MW :45.6kD. Recombinant Mouse Herpesvirus Entry Mediator is produced by our Mammalian expression system and the target gene encoding Gln39-Val207 is expressed with a Fc tag at the C-terminus. Mouse Protein Tnfrsf14, is a type I transmembrane protein belonging to the TNF receptor superfamily. It is tumor necrosis factor receptor superfamily member 14 and expressed on the surface of T cells during the resting state. Interaction of HVEM with TNF family member LIGHT co-stimulates T cells and promotes inflammation. HVEM also triggers inhibitory signaling cascade in effector T (Teff) cells and regulatory T cells (Tregs) as a ligand of B and T lymphocyte attenuator. Tnfrsf14 is detected in peripheral blood T cells, B cells, monocytes and in various tissues enriched in lymphoid cells. It has demonstrated that HVEM Ig is able to exert a significant antiviral effect against HSV-1 infection in vivo.

Product Specifications

Gene Name

Tnfrsf14

Gene ID

230979

UniProt

Q80WM9

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

GYHVKQVCSEHTGTVCAPCPPQTYTAHANGLSKCLPCGVCDPDMGLLTWQECSSWKDTVCRCIPGYFCENQDGSHCSTCLQHTTCPPGQRVEKRGTHDQDTVCADCLTGTFSLGGTQEECLPWTNCSAFQQEVRRGTNSTDTTCSSQVVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
More Discoveries

Explore Other Products

Browse additional items from our catalog

Goose Period Circadian Protein Homolog 2 (PER2) ELISA Kit
MBS9909840 Inquire

Goose Period Circadian Protein Homolog 2 (PER2) ELISA Kit

Sign In for Pricing
View Details
Transglutaminase 3 (TGM3) Antibody
abx433398 200 µL

Transglutaminase 3 (TGM3) Antibody

Sign In for Pricing
View Details
KNG1 Antibody
DF6544-01 100 µL

KNG1 Antibody

Sign In for Pricing
View Details
KNG1 Antibody
DF6544-02 200 µL

KNG1 Antibody

Sign In for Pricing
View Details
Human Putative uncharacterized protein encoded by LINC00052 (LINC00052) ELISA Kit
abx550579 96 Tests

Human Putative uncharacterized protein encoded by LINC00052 (LINC00052) ELISA Kit

Sign In for Pricing
View Details
Rat Riox2 Pre-designed siRNA Set A
SI211944A 1 Each

Rat Riox2 Pre-designed siRNA Set A

Sign In for Pricing
View Details