Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse HVEM/TNFRSF14/TR2/CD270 (C-Fc)

Source: Human Cells. MW :45.6kD. Recombinant Mouse Herpesvirus Entry Mediator is produced by our Mammalian expression system and the target gene encoding Gln39-Val207 is expressed with a Fc tag at the C-terminus. Mouse Protein Tnfrsf14, is a type I transmembrane protein belonging to the TNF receptor superfamily. It is tumor necrosis factor receptor superfamily member 14 and expressed on the surface of T cells during the resting state. Interaction of HVEM with TNF family member LIGHT co-stimulates T cells and promotes inflammation. HVEM also triggers inhibitory signaling cascade in effector T (Teff) cells and regulatory T cells (Tregs) as a ligand of B and T lymphocyte attenuator. Tnfrsf14 is detected in peripheral blood T cells, B cells, monocytes and in various tissues enriched in lymphoid cells. It has demonstrated that HVEM Ig is able to exert a significant antiviral effect against HSV-1 infection in vivo.

Product Specifications

Gene Name

Tnfrsf14

Gene ID

230979

UniProt

Q80WM9

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

GYHVKQVCSEHTGTVCAPCPPQTYTAHANGLSKCLPCGVCDPDMGLLTWQECSSWKDTVCRCIPGYFCENQDGSHCSTCLQHTTCPPGQRVEKRGTHDQDTVCADCLTGTFSLGGTQEECLPWTNCSAFQQEVRRGTNSTDTTCSSQVVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PE-Cy7 Anti-Mouse CD200/OX2 Antibody (OX-90)
PC7-30179U-01 25 µg

PE-Cy7 Anti-Mouse CD200/OX2 Antibody (OX-90)

Ask
View Details
PE-Cy7 Anti-Mouse CD200/OX2 Antibody (OX-90)
PC7-30179U-02 100 µg

PE-Cy7 Anti-Mouse CD200/OX2 Antibody (OX-90)

Ask
View Details
Slc12a6 (NM_133649) Mouse Tagged Lenti ORF Clone
MR226239L4 10 µg

Slc12a6 (NM_133649) Mouse Tagged Lenti ORF Clone

Ask
View Details
CXCL12 (Chemokine (C-X-C Motif) Ligand 12 (Stromal Cell-Derived Factor 1), PBSF, SCYB12, SDF-1a, SDF-1b, SDF1, SDF1A, SDF1B, TLSF-a, TLSF-b, TPAR1) (FITC)
245100-FITC 100 µL

CXCL12 (Chemokine (C-X-C Motif) Ligand 12 (Stromal Cell-Derived Factor 1), PBSF, SCYB12, SDF-1a, SDF-1b, SDF1, SDF1A, SDF1B, TLSF-a, TLSF-b, TPAR1) (FITC)

Ask
View Details
NCAPH (Condensin Complex Subunit 2, Non-SMC Condensin I Complex Subunit H)
486584 100 µL

NCAPH (Condensin Complex Subunit 2, Non-SMC Condensin I Complex Subunit H)

Ask
View Details
Recombinant Mouse ELMO domain-containing protein 1 (Elmod1)
MBS1446576-01 0.02 mg (E-Coli)

Recombinant Mouse ELMO domain-containing protein 1 (Elmod1)

Ask
View Details