Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse IL-15 Receptor Subunit a/CD215/IL-15RA (C-Fc)

Source: Human Cells. MW :45.5kD. Recombinant Mouse Interleukin-15 receptor alpha is produced by our Mammalian expression system and the target gene encoding Gly33-Lys205 is expressed with a Fc tag at the C-terminus. Mouse interleukin-15 receptor subunit alpha, also known as Il15ra, is a high-affinity receptor for interleukin-15. Il15ra associates as a heterotrimer with the IL-2 receptor beta and gamma subunits (Common gamma chain, or gamma c) to initiate signal transduction. It can signal both in cis and trans where IL15R from one subset of cells presents IL15 to neighboring IL2RG-expressing cells. Il15ra is expressed in special cells including a wide variety of Tand B cells and non-lymphoid cells. Human Il15ra shares 45% amino acid sequence homology with the mouse form of the receptor. Eight isoforms of IL-15 R alpha mRNA have been identified, resulting from alternative splicing events involving different exons.

Product Specifications

Gene Name

Il15ra

Gene ID

16169

UniProt

Q60819

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

GTTCPPPVSIEHADIRVKNYSVNSRERYVCNSGFKRKAGTSTLIECVINKNTNVAHWTTPSLKCIRDPSLAHYSPVPTVVTPKVTSQPESPSPSAKEPEAFSPKSDTAMTTETAIMPGSRLTPSQTTSAGTTGTGSHKSSRAPSLAATMTLEPTASTSLRITEISPHSSKMTKVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

GATA3, ID (GATA3, Trans-acting T-cell-specific transcription factor GATA-3, GATA-binding factor 3)
035923 200 µL

GATA3, ID (GATA3, Trans-acting T-cell-specific transcription factor GATA-3, GATA-binding factor 3)

Ask
View Details
Human IgG1 Fc "YTE" Mutation-Specific Binding Antibody, Mouse Monoclonal, 100 µg
MA571B-100 100 µL

Human IgG1 Fc "YTE" Mutation-Specific Binding Antibody, Mouse Monoclonal, 100 µg

Ask
View Details
Cytokeratin 4 Antibody / KRT4
V7910SAF-100UG 100 µg

Cytokeratin 4 Antibody / KRT4

Ask
View Details
PE/Cyanine5 anti-human CD8a
GT06920 25 Tests

PE/Cyanine5 anti-human CD8a

Ask
View Details
XAB2 Protein Vector (Mouse) (pPM-C-HA)
50494024 500 ng

XAB2 Protein Vector (Mouse) (pPM-C-HA)

Ask
View Details