Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Legumain/Asparaginyl Endopeptidase (C-6His)

Source: Human Cells. MW :48.7kD. Recombinant Mouse Legumain/Asparaginyl Endopeptidase is produced by our Mammalian expression system and the target gene encoding Val18-Tyr435 is expressed with a 6His tag at the C-terminus. Mouse Legumain, also known as LGMN, is a cysteine protease belonging to peptidase family C13 and is expressed in kidney and placenta abundantly. LGMN has a strict specificity for hydrolysis of asparaginyl bonds. It can also cleave aspartyl bonds slowly, especially under acidic conditions. The mammalian legumain is involved in the processing of proteins for MHC class II antigen presentation in the lysosomal/endosomal system. It plays a role in the regulation of cell proliferation via its role in EGFR degradation. Legumain deficiency causes the accumulation of pro-Cathepsins B, H and L, another group of lysosomal cysteine proteases. Overexpression of Legumain in tumors is significant for invasion/metastasis. Mammalian legumain is inhibited by iodoacetamide and maleimides. Legumain activation appears to be autocatalytic and can be triggered by acidic pH.

Product Specifications

Gene Name

Lgmn

Gene ID

19141

UniProt

O89017

Components

Supplied as a 0.2 μm filtered solution of 20mM Tris,150mM NaCl,20% Glycerol, pH8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

VPVGVDDPEDGGKHWVVIVAGSNGWYNYRHQADACHAYQIIHRNGIPDEQIIVMMYDDIANSEENPTPGVVINRPNGTDVYKGVLKDYTGEDVTPENFLAVLRGDAEAVKGKGSGKVLKSGPRDHVFIYFTDHGATGILVFPNDDLHVKDLNKTIRYMYEHKMYQKMVFYIEACESGSMMNHLPDDINVYATTAANPKESSYACYYDEERGTYLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHTNTSHVMQYGNKSISTMKVMQFQGMKHRASSPISLPPVTHLDLTPSPDVPLTILKRKLLRTNDVKESQNLIGQIQQFLDARHVIEKSVHKIVSLLAGFGETAERHLSERTMLTAHDCYQEAVTHFRTHCFNWHSVTYEHALRYLYVLANLCEAPYPIDRIEMAMDKVCLSHYVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Exodus 2 (SLC, Secondary Lymphoid-tissue Chemokine, 6Ckine, TCA4) (MaxLight 405)
MBS6475412-01 0.1 mL

Exodus 2 (SLC, Secondary Lymphoid-tissue Chemokine, 6Ckine, TCA4) (MaxLight 405)

Ask
View Details
Exodus 2 (SLC, Secondary Lymphoid-tissue Chemokine, 6Ckine, TCA4) (MaxLight 405)
MBS6475412-02 5x 0.1 mL

Exodus 2 (SLC, Secondary Lymphoid-tissue Chemokine, 6Ckine, TCA4) (MaxLight 405)

Ask
View Details
HMGB1 (High Mobility Group Protein B1)
044886 100 µg

HMGB1 (High Mobility Group Protein B1)

Ask
View Details
Recombinant Yersinia pestis bv. Antiqua UPF0178 protein YPA_2221 (YPA_2221)
MBS1424162-01 0.02 mg (E-Coli)

Recombinant Yersinia pestis bv. Antiqua UPF0178 protein YPA_2221 (YPA_2221)

Ask
View Details
Recombinant Yersinia pestis bv. Antiqua UPF0178 protein YPA_2221 (YPA_2221)
MBS1424162-02 0.1 mg (E-Coli)

Recombinant Yersinia pestis bv. Antiqua UPF0178 protein YPA_2221 (YPA_2221)

Ask
View Details
Recombinant Yersinia pestis bv. Antiqua UPF0178 protein YPA_2221 (YPA_2221)
MBS1424162-03 0.02 mg (Yeast)

Recombinant Yersinia pestis bv. Antiqua UPF0178 protein YPA_2221 (YPA_2221)

Ask
View Details