Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transforming Growth Factor beta-2/TGFB2

Source: Human Cells. MW :12.7kD. Recombinant Human Transforming Growth Factor beta 2 is produced by our Mammalian expression system and the target gene encoding Ala303-Ser414 is expressed. Transforming growth factor beta-2 (TGF- beta2) is a secreted protein which belongs to the TGF-beta family. It is known as a cytokine that performs many cellular functions and has a vital role during embryonic development. The precursor is cleaved into mature TGF-beta-2 and LAP, which remains non-covalently linked to mature TGF-beta-2 rendering it inactive. It is an extracellular glycosylated protein. It is known to suppress the effects of interleukin dependent T-cell tumors. Defects in TGFB2 may be a cause of non-syndromic aortic disease (NSAD) .

Product Specifications

Gene Name

TGFB2

Gene ID

7042

UniProt

P61812

Components

Lyophilized from a 0.2 μm filtered solution of 4 mM HCl.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

(2-Chloroethane) phosphonic Acid-13C2
159512 250 µg

(2-Chloroethane) phosphonic Acid-13C2

Ask
View Details
2-ArmPEG-Mal, 4K
A22022-4K Inquire

2-ArmPEG-Mal, 4K

Ask
View Details
Rabbit Polyclonal Cardiac Leiomodin Antibody [Alexa Fluor 594]
NBP2-97438AF594 0.1 mL

Rabbit Polyclonal Cardiac Leiomodin Antibody [Alexa Fluor 594]

Ask
View Details
Rat pro-Caspase-1 (pro-Casp-1) ELISA Kit
YP-W39080-01 48 Tests

Rat pro-Caspase-1 (pro-Casp-1) ELISA Kit

Ask
View Details
Rat pro-Caspase-1 (pro-Casp-1) ELISA Kit
YP-W39080-02 96 Tests

Rat pro-Caspase-1 (pro-Casp-1) ELISA Kit

Ask
View Details