Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transforming Growth Factor beta-2/TGFB2

Source: Human Cells. MW :12.7kD. Recombinant Human Transforming Growth Factor beta 2 is produced by our Mammalian expression system and the target gene encoding Ala303-Ser414 is expressed. Transforming growth factor beta-2 (TGF- beta2) is a secreted protein which belongs to the TGF-beta family. It is known as a cytokine that performs many cellular functions and has a vital role during embryonic development. The precursor is cleaved into mature TGF-beta-2 and LAP, which remains non-covalently linked to mature TGF-beta-2 rendering it inactive. It is an extracellular glycosylated protein. It is known to suppress the effects of interleukin dependent T-cell tumors. Defects in TGFB2 may be a cause of non-syndromic aortic disease (NSAD) .

Product Specifications

Gene Name

TGFB2

Gene ID

7042

UniProt

P61812

Components

Lyophilized from a 0.2 μm filtered solution of 4 mM HCl.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Solute Carrier Family 27 Member 5 (SLC27A5)
FY-AB40078-01 1 mL

Anti-Solute Carrier Family 27 Member 5 (SLC27A5)

Sign In for Pricing
View Details
Anti-Solute Carrier Family 27 Member 5 (SLC27A5)
FY-AB40078-02 100 µL

Anti-Solute Carrier Family 27 Member 5 (SLC27A5)

Sign In for Pricing
View Details
Anti-Solute Carrier Family 27 Member 5 (SLC27A5)
FY-AB40078-03 200 µL

Anti-Solute Carrier Family 27 Member 5 (SLC27A5)

Sign In for Pricing
View Details
Recombinant Neisseria meningitidis serogroup A / serotype 4A Phosphoribosyl-ATP pyrophosphatase (hisE)
MBS1376891-01 0.02 mg (E-Coli)

Recombinant Neisseria meningitidis serogroup A / serotype 4A Phosphoribosyl-ATP pyrophosphatase (hisE)

Sign In for Pricing
View Details
Recombinant Neisseria meningitidis serogroup A / serotype 4A Phosphoribosyl-ATP pyrophosphatase (hisE)
MBS1376891-02 0.1 mg (E-Coli)

Recombinant Neisseria meningitidis serogroup A / serotype 4A Phosphoribosyl-ATP pyrophosphatase (hisE)

Sign In for Pricing
View Details
Recombinant Neisseria meningitidis serogroup A / serotype 4A Phosphoribosyl-ATP pyrophosphatase (hisE)
MBS1376891-03 0.02 mg (Yeast)

Recombinant Neisseria meningitidis serogroup A / serotype 4A Phosphoribosyl-ATP pyrophosphatase (hisE)

Sign In for Pricing
View Details