Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ephrin-A5/EFNA5 (C-Fc)

Source: Human Cells. MW :48.3kD. Recombinant Human Ephrin-A5 is produced by our Mammalian expression system and the target gene encoding Gln21-Asn203 is expressed with a Fc tag at the C-terminus. Ephrin-A5 (EFNA5) belongs to the ephrin family, contains 1 ephrin RBD (ephrin receptor-binding) domain. Ephrin-A5 is a cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. It binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The interaction of EFNA5 with EPHA5 also mediates communication between pancreatic islet cells to regulate glucose-stimulated insulin secretion. Cognate/functional ligand for EPHA7, their interaction regulates brain development modulating cell-cell adhesion and repulsion.

Product Specifications

Gene Name

EFNA5

Gene ID

1946

UniProt

P52803

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

QDPGSKAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGENVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
More Discoveries

Explore Other Products

Browse additional items from our catalog

ORF61 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4035807 1.0 µg DNA

ORF61 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Anti-T-Cell Surface Glycoprotein CD3 Epsilon (CD3e) Monoclonal Antibody
CAU35816-01 100 µL

Anti-T-Cell Surface Glycoprotein CD3 Epsilon (CD3e) Monoclonal Antibody

Sign In for Pricing
View Details
Anti-T-Cell Surface Glycoprotein CD3 Epsilon (CD3e) Monoclonal Antibody
CAU35816-02 200 µL

Anti-T-Cell Surface Glycoprotein CD3 Epsilon (CD3e) Monoclonal Antibody

Sign In for Pricing
View Details
Anti-T-Cell Surface Glycoprotein CD3 Epsilon (CD3e) Monoclonal Antibody
CAU35816-03 1 mL

Anti-T-Cell Surface Glycoprotein CD3 Epsilon (CD3e) Monoclonal Antibody

Sign In for Pricing
View Details
MEF2A (Myocyte Enhancer Factor 2A, ADCAD1, RSRFC4, RSRFC9) (MaxLight 650)
248635-ML650 100 µL

MEF2A (Myocyte Enhancer Factor 2A, ADCAD1, RSRFC4, RSRFC9) (MaxLight 650)

Sign In for Pricing
View Details
FAM18B2 Protein Vector (Rat) (pPB-C-His)
PV267390 500 ng

FAM18B2 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details