Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ephrin-A5/EFNA5 (C-Fc)

Source: Human Cells. MW :48.3kD. Recombinant Human Ephrin-A5 is produced by our Mammalian expression system and the target gene encoding Gln21-Asn203 is expressed with a Fc tag at the C-terminus. Ephrin-A5 (EFNA5) belongs to the ephrin family, contains 1 ephrin RBD (ephrin receptor-binding) domain. Ephrin-A5 is a cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. It binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The interaction of EFNA5 with EPHA5 also mediates communication between pancreatic islet cells to regulate glucose-stimulated insulin secretion. Cognate/functional ligand for EPHA7, their interaction regulates brain development modulating cell-cell adhesion and repulsion.

Product Specifications

Gene Name

EFNA5

Gene ID

1946

UniProt

P52803

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

QDPGSKAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGENVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human TMEM88B knockdown cell line
ABC-KD15768 1 Vial

Human TMEM88B knockdown cell line

Ask
View Details
Protein Disulfide Isomerase A2 (PDIA2) Antibody
abx210341-01 50 µL

Protein Disulfide Isomerase A2 (PDIA2) Antibody

Ask
View Details
Protein Disulfide Isomerase A2 (PDIA2) Antibody
abx210341-02 100 µL

Protein Disulfide Isomerase A2 (PDIA2) Antibody

Ask
View Details
Human ACY3 activation kit by CRISPRa
GA114145 1 Kit

Human ACY3 activation kit by CRISPRa

Ask
View Details
Esp18 (NM_001244763) Mouse Tagged ORF Clone
MR227797 10 µg

Esp18 (NM_001244763) Mouse Tagged ORF Clone

Ask
View Details
Capza1 Mouse shRNA Lentiviral Particle (Locus ID 12340)
TL500263V 500 µL Each

Capza1 Mouse shRNA Lentiviral Particle (Locus ID 12340)

Ask
View Details