Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Death Receptor 3/DR3/TNFRSF25 (C-Fc)

Source: Human Cells. MW :46.3kD. Recombinant Human Death Receptor 3 is produced by our Mammalian expression system and the target gene encoding Gln25-Phe201 is expressed with a Fc tag at the C-terminus. Tumor necrosis factor receptor superfamily member 25 (TNFRSF25) contains 1 death domain and 4 TNFR-Cys repeats. TNFRSF25 is a cell surface receptor of the tumor necrosis factor receptor superfamily which mediates apoptotic signalling and differentiation, activated by a monogamous ligand, known as TL1A (TNFSF15), which is rapidly upregulated in antigen presenting cells and some endothelial cells following Toll-Like Receptor or Fc receptor activation. This receptor has been shown to signal both through the TRADD adaptor molecule to stimulate NF-kappa B activity or through the FADD adaptor molecule to stimulate caspase activation and regulate cell apoptosis. It may play a role in regulating lymphocyte homeostasis.

Product Specifications

Gene Name

TNFRSF25

Gene ID

8718

UniProt

Q93038

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

QGGTRSPRCDCAGDFHKKIGLFCCRGCPAGHYLKAPCTEPCGNSTCLVCPQDTFLAWENHHNSECARCQACDEQASQVALENCSAVADTRCGCKPGWFVECQVSQCVSSSPFYCQPCLDCGALHRHTRLLCSRRDTDCGTCLPGFYEHGDGCVSCPTSTLGSCPERCAAVCGWRQMFVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Human Serine/threonine-protein kinase TBK1 (TBK1)
MBS1471007-01 0.02 mg (E-Coli)

Recombinant Human Serine/threonine-protein kinase TBK1 (TBK1)

Ask
View Details
Recombinant Human Serine/threonine-protein kinase TBK1 (TBK1)
MBS1471007-02 0.02 mg (Yeast)

Recombinant Human Serine/threonine-protein kinase TBK1 (TBK1)

Ask
View Details
Recombinant Human Serine/threonine-protein kinase TBK1 (TBK1)
MBS1471007-03 0.1 mg (Yeast)

Recombinant Human Serine/threonine-protein kinase TBK1 (TBK1)

Ask
View Details
Recombinant Human Serine/threonine-protein kinase TBK1 (TBK1)
MBS1471007-04 0.1 mg (E-Coli)

Recombinant Human Serine/threonine-protein kinase TBK1 (TBK1)

Ask
View Details
Recombinant Human Serine/threonine-protein kinase TBK1 (TBK1)
MBS1471007-05 0.02 mg (Baculovirus)

Recombinant Human Serine/threonine-protein kinase TBK1 (TBK1)

Ask
View Details
Recombinant Human Serine/threonine-protein kinase TBK1 (TBK1)
MBS1471007-06 0.02 mg (Mammalian-Cell)

Recombinant Human Serine/threonine-protein kinase TBK1 (TBK1)

Ask
View Details