Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Death Receptor 3/DR3/TNFRSF25 (C-Fc)

Source: Human Cells. MW :46.3kD. Recombinant Human Death Receptor 3 is produced by our Mammalian expression system and the target gene encoding Gln25-Phe201 is expressed with a Fc tag at the C-terminus. Tumor necrosis factor receptor superfamily member 25 (TNFRSF25) contains 1 death domain and 4 TNFR-Cys repeats. TNFRSF25 is a cell surface receptor of the tumor necrosis factor receptor superfamily which mediates apoptotic signalling and differentiation, activated by a monogamous ligand, known as TL1A (TNFSF15), which is rapidly upregulated in antigen presenting cells and some endothelial cells following Toll-Like Receptor or Fc receptor activation. This receptor has been shown to signal both through the TRADD adaptor molecule to stimulate NF-kappa B activity or through the FADD adaptor molecule to stimulate caspase activation and regulate cell apoptosis. It may play a role in regulating lymphocyte homeostasis.

Product Specifications

Gene Name

TNFRSF25

Gene ID

8718

UniProt

Q93038

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

QGGTRSPRCDCAGDFHKKIGLFCCRGCPAGHYLKAPCTEPCGNSTCLVCPQDTFLAWENHHNSECARCQACDEQASQVALENCSAVADTRCGCKPGWFVECQVSQCVSSSPFYCQPCLDCGALHRHTRLLCSRRDTDCGTCLPGFYEHGDGCVSCPTSTLGSCPERCAAVCGWRQMFVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal ERK1 Antibody (1A2)
NBP1-74032-100ul 100 µL

Mouse Monoclonal ERK1 Antibody (1A2)

Ask
View Details
Rabbit Polyclonal SCAMP2 Antibody [Alexa Fluor 700]
NB120-3431AF700 0.1 mL

Rabbit Polyclonal SCAMP2 Antibody [Alexa Fluor 700]

Ask
View Details
Absolute Mag™ PEI Gold Coated Magnetic Particles, 100 nm
WHM-GC095 2.5 mg/mL

Absolute Mag™ PEI Gold Coated Magnetic Particles, 100 nm

Ask
View Details
Human Leukocyte Associated Immunoglobulin Like Receptor 2 (LAIR2) Antibody Pair Kit (with Standard)
MBS2099768-01 5x 96 Tests

Human Leukocyte Associated Immunoglobulin Like Receptor 2 (LAIR2) Antibody Pair Kit (with Standard)

Ask
View Details
Human Leukocyte Associated Immunoglobulin Like Receptor 2 (LAIR2) Antibody Pair Kit (with Standard)
MBS2099768-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Human Leukocyte Associated Immunoglobulin Like Receptor 2 (LAIR2) Antibody Pair Kit (with Standard)

Ask
View Details
Human Leukocyte Associated Immunoglobulin Like Receptor 2 (LAIR2) Antibody Pair Kit (with Standard)
MBS2099768-03 10x 96 Tests

Human Leukocyte Associated Immunoglobulin Like Receptor 2 (LAIR2) Antibody Pair Kit (with Standard)

Ask
View Details