Recombinant Human V-Set and Transmembrane Domain-Containing 1/VSTM1 (C-6His)
Source: Human Cells. MW :14.6kD. Recombinant Human VSTM1 is produced by our Mammalian expression system and the target gene encoding Tyr17-Thr135 is expressed with a 6His tag at the C-terminus. V-set and transmembrane domain-containing protein 1 is a single-pass membrane protein. VSTM1 Contains 1 Ig-like V-type domain, in humans is encoded by the VSTM1 gene. It expressed on myeloid (neutrophils, eosinophils and monocytes) but not on lymphoid cells. It behaves as a cytokine, promoting IL17A secretion by CD4+ T-cells, and differentiation and activation of IL17 producing helper T-cells (TH17) . Inhibitory immune receptor involved in the regulation of phagocytes.
Product Specifications
Gene Name
VSTM1
Gene ID
284415
UniProt
Q6UX27
Components
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
YEDEKKNEKPPKPSLHAWPSSVVEAESNVTLKCQAHSQNVTFVLRKVNDSGYKQEQSSAENEAEFPFTDLKPKDAGRYFCAYKTTASHEWSESSEHLQLVVTDKHDELEAPSMKTDTRTVDHHHHHH
Explore Other Products
Browse additional items from our catalog