Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human V-Set and Transmembrane Domain-Containing 1/VSTM1 (C-6His)

Source: Human Cells. MW :14.6kD. Recombinant Human VSTM1 is produced by our Mammalian expression system and the target gene encoding Tyr17-Thr135 is expressed with a 6His tag at the C-terminus. V-set and transmembrane domain-containing protein 1 is a single-pass membrane protein. VSTM1 Contains 1 Ig-like V-type domain, in humans is encoded by the VSTM1 gene. It expressed on myeloid (neutrophils, eosinophils and monocytes) but not on lymphoid cells. It behaves as a cytokine, promoting IL17A secretion by CD4+ T-cells, and differentiation and activation of IL17 producing helper T-cells (TH17) . Inhibitory immune receptor involved in the regulation of phagocytes.

Product Specifications

Gene Name

VSTM1

Gene ID

284415

UniProt

Q6UX27

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

YEDEKKNEKPPKPSLHAWPSSVVEAESNVTLKCQAHSQNVTFVLRKVNDSGYKQEQSSAENEAEFPFTDLKPKDAGRYFCAYKTTASHEWSESSEHLQLVVTDKHDELEAPSMKTDTRTVDHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Listeria welshimeri serovar 6b Formate--tetrahydrofolate ligase (fhs), partial
MBS1012071 Inquire

Recombinant Listeria welshimeri serovar 6b Formate--tetrahydrofolate ligase (fhs), partial

Ask
View Details
2-Hydroxycinnamic acid
HY-W012531-01 100 mg

2-Hydroxycinnamic acid

Ask
View Details
2-Hydroxycinnamic acid
HY-W012531-02 10 mM - 1 mL

2-Hydroxycinnamic acid

Ask
View Details
2-Hydroxycinnamic acid
HY-W012531-03 500 mg

2-Hydroxycinnamic acid

Ask
View Details
2-Hydroxycinnamic acid
HY-W012531-04 1 g

2-Hydroxycinnamic acid

Ask
View Details
2-Hydroxycinnamic acid
HY-W012531-05 5 g

2-Hydroxycinnamic acid

Ask
View Details