Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human DCBLD2/ESDN (C-6His)

Source: Human Cells. MW :52.2kD. Recombinant Human DCBLD2 is produced by our Mammalian expression system and the target gene encoding Gln67-Ala528 is expressed with a 6His tag at the C-terminus. Discoidin, CUB and LCCL domain-containing protein 2 (DCBLD2) is a protein contains 1 CUB domain, 1 F5/8 type C domain, 1 LCCL domain. DCBLD2 is Highly expressed in testis, heart, skeletal muscle and also in cultured vascular smooth muscle cells. Model organisms have been used in the study of DCBLD2 function. Male and female animals underwent a standardized phenotypic screen to determine the effects of deletion. Additional screens performed: In-depth immunological phenotyping.

Product Specifications

Gene Name

DCBLD2

Gene ID

131566

UniProt

Q96PD2

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

QQGDGCGHTVLGPESGTLTSINYPQTYPNSTVCEWEIRVKMGERVRIKFGDFDIEDSDSCHFNYLRIYNGIGVSRTEIGKYCGLGLQMNHSIESKGNEITLLFMSGIHVSGRGFLASYSVIDKQDLITCLDTASNFLEPEFSKYCPAGCLLPFAEISGTIPHGYRDSSPLCMAGVHAGVVSNTLGGQISVVISKGIPYYESSLANNVTSVVGHLSTSLFTFKTSGCYGTLGMESGVIADPQITASSVLEWTDHTGQENSWKPKKARLKKPGPPWAAFATDEYQWLQIDLNKEKKITGIITTGSTMVEHNYYVSAYRILYSDDGQKWTVYREPGVEQDKIFQGNKDYHQDVRNNFLPPIIARFIRVNPTQWQQKIAMKMELLGCQFIPKGRPPKLTQPPPPRNSNDLKNTTAPPKIAKGRAPKFTQPLQPRSSNEFPAQTEQTTASPDIRNTTVTPNVTKDVAVDHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM125B sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0744805 3x 1.0 µg

FAM125B sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
ZSCAN21 Antibody, HRP conjugated
A45432-100UG 100 µg

ZSCAN21 Antibody, HRP conjugated

Sign In for Pricing
View Details
Lentiviral human GOLPH3L shRNA (UAS) - Lentiviral human GOLPH3L shRNA (UAS, GFP) (25)
GTR15106772 1 Vial

Lentiviral human GOLPH3L shRNA (UAS) - Lentiviral human GOLPH3L shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
ZNF652 (NM_014897) Human Over-expression Lysate
LH09411V 100 µg

ZNF652 (NM_014897) Human Over-expression Lysate

Sign In for Pricing
View Details
1-[2- (benzyloxy) phenyl]-3-[4- (1,1,1-trimethylammonio) phenyl]prop-2-en-1-one iodide
OR26368 1 Each

1-[2- (benzyloxy) phenyl]-3-[4- (1,1,1-trimethylammonio) phenyl]prop-2-en-1-one iodide

Sign In for Pricing
View Details
Rad51 Rabbit Monoclonal Antibody, 1 pack = 50 µL
BAL5195 1 Each

Rad51 Rabbit Monoclonal Antibody, 1 pack = 50 µL

Sign In for Pricing
View Details