Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-11/IL-11 (C-Fc)

Source: Human Cells. MW :46.3kD. Recombinant Mouse Interleukin-11 is produced by our Mammalian expression system and the target gene encoding Pro22-Leu199 is expressed with a Fc tag at the C-terminus. Interleukin-11 (IL-11) is a secreted protein and belongs to the IL-6 superfamily. IL-11 has been demonstrated to improve platelet recovery after chemotherapy-induced thrombocytopenia, induceacute phase proteins, modulate antigen-antibody responses, participate in the regulation of bone cellproliferation and differentiation and could be use as a therapeutic for osteoporosis. IL-11 stimulates the growth of certain lymphocytes and, in the murine model, stimulates an increase in the cortical thickness and strength of long bones. In addition to having lymphopoietic/hematopoietic and osteotrophic properties, it has functions in many other tissues, including the brain, gut, testis and bone.

Product Specifications

Gene Name

Il11

Gene ID

16156

UniProt

P47873

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

PGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHSLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYLRHVQWLRRAGGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPVIPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRLVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse UCN2 (Urocortin 2) ELISA Kit
ELK7714-01 48 Tests

Mouse UCN2 (Urocortin 2) ELISA Kit

Ask
View Details
Mouse UCN2 (Urocortin 2) ELISA Kit
ELK7714-02 96 Tests

Mouse UCN2 (Urocortin 2) ELISA Kit

Ask
View Details
Mouse UCN2 (Urocortin 2) ELISA Kit
ELK7714-03 5x 96 Tests

Mouse UCN2 (Urocortin 2) ELISA Kit

Ask
View Details
Anti-Human EFNA4 Antibody (SAA1644)
MBS1570604-01 0.1 mg

Anti-Human EFNA4 Antibody (SAA1644)

Ask
View Details
Anti-Human EFNA4 Antibody (SAA1644)
MBS1570604-02 1 mg

Anti-Human EFNA4 Antibody (SAA1644)

Ask
View Details
Anti-Human EFNA4 Antibody (SAA1644)
MBS1570604-03 5x 1 mg

Anti-Human EFNA4 Antibody (SAA1644)

Ask
View Details