Recombinant Mouse TACI/TNFRSF13B/CD267 (C-Fc)
Source: Human Cells. MW :41.4kD. Recombinant Mouse Transmembrane Activator and CAML Interactor is produced by our Mammalian expression system and the target gene encoding Phe5-Thr129 is expressed with a Fc tag at the C-terminus. Tumor necrosis factor receptor superfamily member 13B, also known as TNFRSF13B or more commonly as TACI (transmembrane activator and CAML interactor), is a transmembrane receptor protein found predominantly on the surface of B cells, which are an important part of the immune system.
Product Specifications
Gene Name
Tnfrsf13b
Gene ID
57916
UniProt
Q9ET35
Components
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
MFCPKDQYWDSSRKSCVSCALTCSQRSQRTCTDFCKFINCRKEQGRYYDHLLGACVSCDSTCTQHPQQCAHFCEKRPRSQANLQPELGRPQAGEVEVRSDNSGRHQGSEHGPGLRLSSDQLTLYCTVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470026-500 1x 500 µL
ACTH (Adrenocorticotrophic Hormone) (AH26), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880630-100 1x 100 µL
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400806-500 1x 500 µL
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details