Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human IL-2 Receptor Subunit gamma/IL-2RG/CD132 (C-Fc)

Source: Human Cells. MW :55.4kD. Recombinant Human Cytokine receptor common subunit gamma is produced by our Mammalian expression system and the target gene encoding Leu23-Ala262 is expressed with a Fc tag at the C-terminus. IL2RG contains one fibronectin type-III domain. IL2RG is an important signaling component of many interleukin receptors, including those of interleukin -2, -4, -7 and -21, and is thus referred to as the common gamma chain. IL2RG interacts with SHB upon interleukin stimulation and HTLV-1 accessory protein p12I. Defects in IL2RG are the cause of X-linked combined immunodeficiency (XCID) and severe combined immunodeficiency X-linked T-cell-negative /B-cell-positive / NK-cell-negative (XSCID) .

Product Specifications

Gene Name

IL2RG

Gene ID

3561

UniProt

P31785

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

LNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENPFLFALEAVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Anti-Human APP/Amyloid beta Antibody (12A11)
HY235033-01 50 µg

Anti-Human APP/Amyloid beta Antibody (12A11)

Ask
View Details
Anti-Human APP/Amyloid beta Antibody (12A11)
HY235033-02 100 µg

Anti-Human APP/Amyloid beta Antibody (12A11)

Ask
View Details
Anti-Human APP/Amyloid beta Antibody (12A11)
HY235033-03 1 mg

Anti-Human APP/Amyloid beta Antibody (12A11)

Ask
View Details
Mouse Irak1 (NM_001177975) AAV Particle
MR227181A1V 250 µL

Mouse Irak1 (NM_001177975) AAV Particle

Ask
View Details
TBC1D2 (NM_001267572) Human Tagged ORF Clone
RC234192 10 µg

TBC1D2 (NM_001267572) Human Tagged ORF Clone

Ask
View Details
Mthfd1l (BC030437) Mouse Tagged ORF Clone Lentiviral Particle
MR210353L3V 200 µL

Mthfd1l (BC030437) Mouse Tagged ORF Clone Lentiviral Particle

Ask
View Details