Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse GM-CSF/CSF2 (C-6His)

Source: Human Cells. MW :15.1kD. Recombinant Mouse Granulocyte-Macrophage Colony-Stimulating Factor is produced by our Mammalian expression system and the target gene encoding Ala18-Lys141 is expressed with a 6His tag at the C-terminus. Granulocyte-Macrophage Colony Stimulating Factor (GM-CSF) was initially characterized as a growth factorthat can support the in vitro colony formation of granulocyte-macrophage progenitors. It is produced by anumber of different cell types (including activated T cells, B cells, macrophages, mast cells, endothelial cellsand fibroblasts) in response to cytokine of immune and inflammatory stimuli. Besides granulocyte-macrophageprogenitors, GM-CSF is also a growth factor for erythroid, megakaryocyte and eosinophil progenitors. Onmature hematopoietic, monocytes/ macrophages and eosinophils. GM-CSF has a functional role on nonhematopoitic cells. It can induce human endothelial cells to migrate and proliferate. Additionally, GM-CSF canalso stimulate the proliferation of a number of tumor cell lines, including osteogenic sarcoma, carcinoma andadenocarcinoma cell lines.

Product Specifications

Gene Name

Csf2

Gene ID

12981

UniProt

P01587

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQKVDHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Corynebacterium efficiens Glutamate-binding protein (gluB)
MBS1332858-01 0.02 mg (E-Coli)

Recombinant Corynebacterium efficiens Glutamate-binding protein (gluB)

Ask
View Details
Recombinant Corynebacterium efficiens Glutamate-binding protein (gluB)
MBS1332858-02 0.02 mg (Yeast)

Recombinant Corynebacterium efficiens Glutamate-binding protein (gluB)

Ask
View Details
Recombinant Corynebacterium efficiens Glutamate-binding protein (gluB)
MBS1332858-03 0.1 mg (E-Coli)

Recombinant Corynebacterium efficiens Glutamate-binding protein (gluB)

Ask
View Details
Recombinant Corynebacterium efficiens Glutamate-binding protein (gluB)
MBS1332858-04 0.1 mg (Yeast)

Recombinant Corynebacterium efficiens Glutamate-binding protein (gluB)

Ask
View Details
Recombinant Corynebacterium efficiens Glutamate-binding protein (gluB)
MBS1332858-05 0.02 mg (Baculovirus)

Recombinant Corynebacterium efficiens Glutamate-binding protein (gluB)

Ask
View Details
Recombinant Corynebacterium efficiens Glutamate-binding protein (gluB)
MBS1332858-06 0.02 mg (Mammalian-Cell)

Recombinant Corynebacterium efficiens Glutamate-binding protein (gluB)

Ask
View Details