Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transforming Growth Factor beta-3/TGFB3

Source: Human Cells. MW :12.7kD. Recombinant Human/Mouse Transforming Growth Factor beta 3 is produced by our Mammalian expression system and the target gene encoding Ala301-Ser412 (Tyr340Phe) is expressed. Transforming growth factor beta 3 (TGFB3) is a member of a TGF - beta superfamily which is defined by theirstructural and functional similarities. TGFB3 is secreted as a complex with LAP. This latent form of TGFB3becomes active upon cleavage by plasmin, matrix metalloproteases, thrombospondin -1, and a subset ofintegrins. It binds with high affinity to TGF- beta RII, a type II serine/threonine kinase receptor. TGFB3 is involved incell differentiation, embryogenesis and development.It is believed to regulate molecules involved in cellularadhesion and extracellular matrix (ECM) formation during the process of palate development. Without TGF- beta3, mammals develop a deformity known as a cleft palate.

Product Specifications

Gene Name

TGFB3

Gene ID

7043

UniProt

P10600

Components

Lyophilized from a 0.2 μm filtered solution of 4 mM HCl.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYFANFCSGPCPYLRSADTTHSTVLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Microcystis aeruginosa Photosystem II protein Y (psbY), partial
MBS1069197-01 1 mg (E-Coli)

Recombinant Microcystis aeruginosa Photosystem II protein Y (psbY), partial

Ask
View Details
Recombinant Microcystis aeruginosa Photosystem II protein Y (psbY), partial
MBS1069197-02 1 mg (Yeast)

Recombinant Microcystis aeruginosa Photosystem II protein Y (psbY), partial

Ask
View Details
Human Mammary carcinoma Marker ELISA Kit
MBS727271-01 48 Well

Human Mammary carcinoma Marker ELISA Kit

Ask
View Details
Human Mammary carcinoma Marker ELISA Kit
MBS727271-02 96 Well

Human Mammary carcinoma Marker ELISA Kit

Ask
View Details
Human Mammary carcinoma Marker ELISA Kit
MBS727271-03 5x 96 Well

Human Mammary carcinoma Marker ELISA Kit

Ask
View Details
Human Mammary carcinoma Marker ELISA Kit
MBS727271-04 10x 96 Well

Human Mammary carcinoma Marker ELISA Kit

Ask
View Details