Recombinant Human Transforming Growth Factor beta-3/TGFB3
Source: Human Cells. MW :12.7kD. Recombinant Human/Mouse Transforming Growth Factor beta 3 is produced by our Mammalian expression system and the target gene encoding Ala301-Ser412 (Tyr340Phe) is expressed. Transforming growth factor beta 3 (TGFB3) is a member of a TGF - beta superfamily which is defined by theirstructural and functional similarities. TGFB3 is secreted as a complex with LAP. This latent form of TGFB3becomes active upon cleavage by plasmin, matrix metalloproteases, thrombospondin -1, and a subset ofintegrins. It binds with high affinity to TGF- beta RII, a type II serine/threonine kinase receptor. TGFB3 is involved incell differentiation, embryogenesis and development.It is believed to regulate molecules involved in cellularadhesion and extracellular matrix (ECM) formation during the process of palate development. Without TGF- beta3, mammals develop a deformity known as a cleft palate.
Product Specifications
Gene Name
TGFB3
Gene ID
7043
UniProt
P10600
Components
Lyophilized from a 0.2 μm filtered solution of 4 mM HCl.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYFANFCSGPCPYLRSADTTHSTVLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items