Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Lithostathine-2/Reg2 (N-6His)

Source: Human Cells. MW :17.7kD. Recombinant Mouse Islets of Langerhans regenerating protein 2 is produced by our Mammalian expression system and the target gene encoding Gln23-Ala173 is expressed with a 6His tag at the N-terminus. Regenerating protein 2 (Reg2) also known as Lithostathine 2, pancreatic thread protein (PTP2) and pancreatic stone protein 2 (PSP2), is a member of the Reg family of proteins. These small, secreted proteins have been implicated in a range of physiological processes including acting as acute phase reactants, lectins, survival/growth factors for insulin-producing pancreatic beta-cells, neural cells, and epithelial cells of the digestive system. Studies also indicate a role for Reg family members in tumor formation and indicate their potential for use as biomarkers of carcinogenesis. Mouse Reg2 is expressed in regenerating islets and normal exocrine pancreas. Reg2 also stimulates the growth of pancreatic beta cells. Mouse Reg2 belongs to the type II subclass of the Reg family and is the only subclass II Reg protein described.

Product Specifications

Gene Name

Reg2

Gene ID

19693

UniProt

Q08731

Components

Lyophilized from a 0.2 μm filtered solution of PBS pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

HHHHHHQVAEEDFPLAEKDLPSAKINCPEGANAYGSYCYYLIEDRLTWGEADLFCQNMNAGHLVSILSQAESNFVASLVKESGTTASNVWTGLHDPKSNRRWHWSSGSLFLFKSWATGAPSTANRGYCVSLTSNTAYKKWKDENCEAQYSFVCKFRA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CPNE1 Human qPCR Template Standard (NM_152930)
HK211974 1 Kit

CPNE1 Human qPCR Template Standard (NM_152930)

Sign In for Pricing
View Details
IGSF1, CT (IGSF1, IGDC1, KIAA0364, PGSF2, Immunoglobulin superfamily member 1, Immunoglobulin-like domain-containing protein 1, Inhibin-binding protein, Pituitary gland-specific factor 2, p120) (APC)
MBS6309575-01 0.2 mL

IGSF1, CT (IGSF1, IGDC1, KIAA0364, PGSF2, Immunoglobulin superfamily member 1, Immunoglobulin-like domain-containing protein 1, Inhibin-binding protein, Pituitary gland-specific factor 2, p120) (APC)

Sign In for Pricing
View Details
IGSF1, CT (IGSF1, IGDC1, KIAA0364, PGSF2, Immunoglobulin superfamily member 1, Immunoglobulin-like domain-containing protein 1, Inhibin-binding protein, Pituitary gland-specific factor 2, p120) (APC)
MBS6309575-02 5x 0.2 mL

IGSF1, CT (IGSF1, IGDC1, KIAA0364, PGSF2, Immunoglobulin superfamily member 1, Immunoglobulin-like domain-containing protein 1, Inhibin-binding protein, Pituitary gland-specific factor 2, p120) (APC)

Sign In for Pricing
View Details
Recombinant Bacillus anthracis Protein-glutamine gamma-glutamyltransferase (tgl)
MBS1297028-01 0.02 mg (E-Coli)

Recombinant Bacillus anthracis Protein-glutamine gamma-glutamyltransferase (tgl)

Sign In for Pricing
View Details
Recombinant Bacillus anthracis Protein-glutamine gamma-glutamyltransferase (tgl)
MBS1297028-02 0.02 mg (Yeast)

Recombinant Bacillus anthracis Protein-glutamine gamma-glutamyltransferase (tgl)

Sign In for Pricing
View Details
Recombinant Bacillus anthracis Protein-glutamine gamma-glutamyltransferase (tgl)
MBS1297028-03 0.1 mg (E-Coli)

Recombinant Bacillus anthracis Protein-glutamine gamma-glutamyltransferase (tgl)

Sign In for Pricing
View Details