Recombinant Human Cytochrome b5 B/CYB5B (C-6His)
Source: Human Cells. MW :14kD. Recombinant Human Cytochrome b5 B is produced by our Mammalian expression system and the target gene encoding Lys12-Cys118 is expressed with a 6His tag at the C-terminus. Cytochrome b5 type B (CYB5B) is a membrane of the cytochrome b5 family. It contains 1 cytochrome b5 heme-binding domain. Cytochrome b5 is a membrane bound hemoprotein which function as an electron carrier for several membrane bound oxygenases. In the mitochondrion of eukaryotes and in aerobic prokaryotes, cytochrome b is a component of respiratory chain complex III also known as the bc1 complex or ubiquinol-cytochrome c reductase.
Product Specifications
Gene Name
CYB5B
Gene ID
80777
UniProt
O43169
Components
Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
KGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKDPSKNDTCKSCVDHHHHHH
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items