Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cytochrome b5 B/CYB5B (C-6His)

Source: Human Cells. MW :14kD. Recombinant Human Cytochrome b5 B is produced by our Mammalian expression system and the target gene encoding Lys12-Cys118 is expressed with a 6His tag at the C-terminus. Cytochrome b5 type B (CYB5B) is a membrane of the cytochrome b5 family. It contains 1 cytochrome b5 heme-binding domain. Cytochrome b5 is a membrane bound hemoprotein which function as an electron carrier for several membrane bound oxygenases. In the mitochondrion of eukaryotes and in aerobic prokaryotes, cytochrome b is a component of respiratory chain complex III also known as the bc1 complex or ubiquinol-cytochrome c reductase.

Product Specifications

Gene Name

CYB5B

Gene ID

80777

UniProt

O43169

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

KGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKDPSKNDTCKSCVDHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Cd3g (NM_001077646) Rat Untagged Clone
RN208762 10 µg

Cd3g (NM_001077646) Rat Untagged Clone

Ask
View Details
CD200 His Tag Protein, Human
UA010545-01 25 µg

CD200 His Tag Protein, Human

Ask
View Details
CD200 His Tag Protein, Human
UA010545-02 100 µg

CD200 His Tag Protein, Human

Ask
View Details
CD200 His Tag Protein, Human
UA010545-03 500 µg

CD200 His Tag Protein, Human

Ask
View Details
Rat Anti-Mouse CD62L/L-selectin-PE
MBS673419-01 0.2 mg

Rat Anti-Mouse CD62L/L-selectin-PE

Ask
View Details
Rat Anti-Mouse CD62L/L-selectin-PE
MBS673419-02 5x 0.2 mg

Rat Anti-Mouse CD62L/L-selectin-PE

Ask
View Details