Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Hematopoietic Lineage Cell-Specific Protein/HCLS1 (C-6His)

Source: Human Cells. MW :55kD. Recombinant Human Hematopoietic lineage cell-specific protein is produced by our Mammalian expression system and the target gene encoding Met1-Glu486 is expressed with a 6His tag at the C-terminus. Hematopoietic lineage cell-specific protein (HCLS1) is a protein that in humans is encoded by the HCLS1 gene. It is expressed only in tissues and cells of hematopoietic origin. It is substrate of the antigen receptor-coupled tyrosine kinase and plays a role in antigen receptor signaling for both clonal expansion and deletion in lymphoid cells. It may also be involved in the regulation of gene expression.

Product Specifications

Gene Name

HCLS1

Gene ID

3059

UniProt

P14317

Components

Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MWKSVVGHDVSVSVETQGDDWDTDPDFVNDISEKEQRWGAKTIEGSGRTEHINIHQLRNKVSEEHDVLRKKEMESGPKASHGYGGRFGVERDRMDKSAVGHEYVAEVEKHSSQTDAAKGFGGKYGVERDRADKSAVGFDYKGEVEKHTSQKDYSRGFGGRYGVEKDKWDKAALGYDYKGETEKHESQRDYAKGFGGQYGIQKDRVDKSAVGFNEMEAPTTAYKKTTPIEAASSGTRGLKAKFESMAEEKRKREEEEKAQQVARRQQERKAVTKRSPEAPQPVIAMEEPAVPAPLPKKISSEAWPPVGTPPSSESEPVRTSREHPVPLLPIRQTLPEDNEEPPALPPRTLEGLQVEEEPVYEAEPEPEPEPEPEPENDYEDVEEMDRHEQEDEPEGDYEEVLEPEDSSFSSALAGSSGCPAVDHHHHHHGAGAGAVALGISAVAVYDYQGEGSDELSFDPDDVITDIEMVDEGWWRGRCHGHFGLFPANYVKLLE
More Discoveries

Explore Other Products

Browse additional items from our catalog

Slx1b siRNA Oligos set (Rat)
44387176 3x 5 nmol

Slx1b siRNA Oligos set (Rat)

Sign In for Pricing
View Details
VIP (human, mouse, rat) . AcOH [RLF-100]
15-4010-1 1 mg

VIP (human, mouse, rat) . AcOH [RLF-100]

Sign In for Pricing
View Details
Ubiquitously Expressed Transcript (UXT) Polyclonal Antibody
MBS2032813-01 0.1 mL

Ubiquitously Expressed Transcript (UXT) Polyclonal Antibody

Sign In for Pricing
View Details
Ubiquitously Expressed Transcript (UXT) Polyclonal Antibody
MBS2032813-02 0.2 mL

Ubiquitously Expressed Transcript (UXT) Polyclonal Antibody

Sign In for Pricing
View Details
Ubiquitously Expressed Transcript (UXT) Polyclonal Antibody
MBS2032813-03 0.5 mL

Ubiquitously Expressed Transcript (UXT) Polyclonal Antibody

Sign In for Pricing
View Details
Ubiquitously Expressed Transcript (UXT) Polyclonal Antibody
MBS2032813-04 1 mL

Ubiquitously Expressed Transcript (UXT) Polyclonal Antibody

Sign In for Pricing
View Details