Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Serpin B9/SERPINB9 (C-6His)

Source: Human Cells. MW :43.4kD. Recombinant Human Serpin B9 is produced by our Mammalian expression system and the target gene encoding Met1-Pro376 is expressed with a 6His tag at the C-terminus. Serpin B9 belongs to the large superfamily of serine proteinase inhibitors (serpins), which bind to and inactivate serine proteinases. Serpin B9 is an inhibitor of the granzyme B/perforin lytic pathway. It is expressed in normal mammary epithelial cells but not in most mammary carcinoma cell lines. These interactions are involved in many cellular processes, including coagulation, fibrinolysis, complement fixation, matrix remodeling, and apoptosis.

Product Specifications

Gene Name

SERPINB9

Gene ID

5272

UniProt

P50453

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

METLSNASGTFAIRLLKILCQDNPSHNVFCSPVSISSALAMVLLGAKGNTATQMAQALSLNTEEDIHRAFQSLLTEVNKAGTQYLLRTANRLFGEKTCQFLSTFKESCLQFYHAELKELSFIRAAEESRKHINTWVSKKTEGKIEELLPGSSIDAETRLVLVNAIYFKGKWNEPFDETYTREMPFKINQEEQRPVQMMYQEATFKLAHVGEVRAQLLELPYARKELSLLVLLPDDGVELSTVEKSLTFEKLTAWTKPDCMKSTEVEVLLPKFKLQEDYDMESVLRHLGIVDAFQQGKADLSAMSAERDLCLSKFVHKSFVEVNEEGTEAAAASSCFVVAECCMESGPRFCADHPFLFFIRHNRANSILFCGRFSSPVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TNFAIP8L3, ID (TNFAIP8L3, Tumor necrosis factor alpha-induced protein 8-like protein 3) (MaxLight 405)
MBS6356872-01 0.1 mL

TNFAIP8L3, ID (TNFAIP8L3, Tumor necrosis factor alpha-induced protein 8-like protein 3) (MaxLight 405)

Ask
View Details
TNFAIP8L3, ID (TNFAIP8L3, Tumor necrosis factor alpha-induced protein 8-like protein 3) (MaxLight 405)
MBS6356872-02 5x 0.1 mL

TNFAIP8L3, ID (TNFAIP8L3, Tumor necrosis factor alpha-induced protein 8-like protein 3) (MaxLight 405)

Ask
View Details
Rabbit anti-SHIP1 (pY1021) Antibody
YLD7159-01 50 µL

Rabbit anti-SHIP1 (pY1021) Antibody

Ask
View Details
Rabbit anti-SHIP1 (pY1021) Antibody
YLD7159-02 100 µL

Rabbit anti-SHIP1 (pY1021) Antibody

Ask
View Details
Lentiviral human CD3D shRNA (UAS) - Lentiviral human CD3D shRNA (UAS, RFP) (100)
GTR15322767 1 Vial

Lentiviral human CD3D shRNA (UAS) - Lentiviral human CD3D shRNA (UAS, RFP) (100)

Ask
View Details
Lentiviral mouse Sulf1 shRNA (UAS) - Lentiviral mouse Sulf1 shRNA (UAS, iRFP) plasmid
GTR15210808 1 Vial

Lentiviral mouse Sulf1 shRNA (UAS) - Lentiviral mouse Sulf1 shRNA (UAS, iRFP) plasmid

Ask
View Details