Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C-X-C Motif Chemokine 4/CXCL4/PF4 (C-6His)

Source: Human Cells. MW :8.5kD. Recombinant Human C-X-C Motif Chemokine 4 is produced by our Mammalian expression system and the target gene encoding Glu32-Ser101 is expressed with a 6His tag at the C-terminus. Human Chemokine (C-X-C motif) Ligand 4 (CXCL4) is expressed in megakaryocytes and stored in the alpha-granules of platelets. CXCL4 contains several heparin-binding sites at the C-terminal region and binds heparin with high affinity. The active CXCL4 protein is a tetramer. Human and mouse CXCL4 share 64% sequence identity. CXCL4 is chemotactic for neutrophils, fibroblasts and monocytes and plays a critical role in inflammation and wound repair. CXCL4 functions via a splice variant of the chemokine receptor CXCR3, known as CXCR3B. The major physiologic role of CXCL4 appears to be neutralization of heparin-like molecules on the endothelial surface of blood vessels, thereby inhibiting local antithrombin III activity and promoting coagulation. In contrast to other CXC chemokines, CXCL4 lacks chemotactic activity for polymorphonuclear granulocytes.

Product Specifications

Gene Name

PF4

Gene ID

5196

UniProt

P02776

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLESHHHHHH

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tes sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6683906 1.0 µg DNA

Tes sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
PIK3R4 (Phosphoinositide-3-kinase, Regulatory Subunit 4, p150, VPS15) (Biotin)
MBS6431668-01 0.1 mL

PIK3R4 (Phosphoinositide-3-kinase, Regulatory Subunit 4, p150, VPS15) (Biotin)

Sign In for Pricing
View Details
PIK3R4 (Phosphoinositide-3-kinase, Regulatory Subunit 4, p150, VPS15) (Biotin)
MBS6431668-02 5x 0.1 mL

PIK3R4 (Phosphoinositide-3-kinase, Regulatory Subunit 4, p150, VPS15) (Biotin)

Sign In for Pricing
View Details
Nori® Human 14-3-3 β ELISA Kit
GR111218 96 Well

Nori® Human 14-3-3 β ELISA Kit

Sign In for Pricing
View Details
IDH2 (NM_002168) Human Tagged Lenti ORF Clone
RC201152L3 10 µg

IDH2 (NM_002168) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mouse Monoclonal Fascin Antibody (OTI3B4) [DyLight 488]
NBP2-71294G 0.1 mL

Mouse Monoclonal Fascin Antibody (OTI3B4) [DyLight 488]

Sign In for Pricing
View Details