Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C-X-C Motif Chemokine 4/CXCL4/PF4 (C-6His)

Source: Human Cells. MW :8.5kD. Recombinant Human C-X-C Motif Chemokine 4 is produced by our Mammalian expression system and the target gene encoding Glu32-Ser101 is expressed with a 6His tag at the C-terminus. Human Chemokine (C-X-C motif) Ligand 4 (CXCL4) is expressed in megakaryocytes and stored in the alpha-granules of platelets. CXCL4 contains several heparin-binding sites at the C-terminal region and binds heparin with high affinity. The active CXCL4 protein is a tetramer. Human and mouse CXCL4 share 64% sequence identity. CXCL4 is chemotactic for neutrophils, fibroblasts and monocytes and plays a critical role in inflammation and wound repair. CXCL4 functions via a splice variant of the chemokine receptor CXCR3, known as CXCR3B. The major physiologic role of CXCL4 appears to be neutralization of heparin-like molecules on the endothelial surface of blood vessels, thereby inhibiting local antithrombin III activity and promoting coagulation. In contrast to other CXC chemokines, CXCL4 lacks chemotactic activity for polymorphonuclear granulocytes.

Product Specifications

Gene Name

PF4

Gene ID

5196

UniProt

P02776

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLESHHHHHH

More Discoveries

Explore Other Products

Browse additional items from our catalog

BCAS2 Rabbit pAb
E45R25496N-100 100 µL

BCAS2 Rabbit pAb

Sign In for Pricing
View Details
Rabbit F III ELISA Kit
ERTF0201 96 Tests

Rabbit F III ELISA Kit

Sign In for Pricing
View Details
Nrxn1 3'UTR GFP Stable Cell Line
TU264205 1.0 mL

Nrxn1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
NLRP6 Antibody, Biotin conjugated
A29761-100UG 100 µg

NLRP6 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Compound STOCK1N-92407
MF-0026069-01 10mg

Compound STOCK1N-92407

Sign In for Pricing
View Details
Compound STOCK1N-92407
MF-0026069-02 1g

Compound STOCK1N-92407

Sign In for Pricing
View Details