Recombinant Human Retinoic Acid Receptor Responder Protein 2/Chemerin/TIG2 (C-6His)
Source: Human Cells. MW :16.9kD. Recombinant Human Chemerin is produced by our Mammalian expression system and the target gene encoding Glu21-Ser157 is expressed with a 6His tag at the C-terminus. Retinoic acid receptor responder protein 2 (RARRES2) is a secreted protein that in humans is encoded by the RARRES2 gene. It is highly expressed in skin, also found in pancreas, liver, spleen, prostate, ovary, small intestine and colon. It is a chemoattractant protein that acts as a ligand for the G protein-coupled receptor CMKLR1. RARRES2 is secreted in an inactive form as prochemerin and is activated through cleavage of the C-terminus by inflammatory and coagulation serine proteases. It is thought to act as a cell surface receptor, found to stimulate chemotaxis of dendritic cells and macrophages to the site of inflammation. RARRES2 is inhibited in psoriatic lesions, it is activated by tazarotene in skin rafts and in the epidermis of psoriatic lesions.
Product Specifications
Gene Name
RARRES2
Gene ID
5919
UniProt
Q99969
Components
Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
ELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFSVDHHHHHH
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog