Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Plasma Kallikrein/KLKB1 (C-6His)

Source: Human Cells. MW :70.2kD. Recombinant Human Plasma kallikrein is produced by our Mammalian expression system and the target gene encoding Gly20-Ala638 is expressed with a 6His tag at the C-terminus. KLKB1 is a 638 amino acids protein that belongs to the peptidase S1 family and plasma kallikrein subfamily. It contains a peptidase S1 domain and four apple domains. The enzyme cleaves Lys-Arg and Arg-Ser bonds. It activates, in a reciprocal reaction, factor XII after its binding to a negatively charged surface. It also releases bradykinin from HMW kininogen and may also play a role in the renin-angiotensin system by converting prorenin into renin. It participates in the surface-dependent activation of blood coagulation, fibrinolysis, kinin generation and inflammation.Plasma prekallikrein deficiency causes a prolonged activated partial thromboplastin time in patients.

Product Specifications

Gene Name

KLKB1

Gene ID

3818

UniProt

P03952

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl,150mM NaCl,10% Glycerol, pH8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

GCLTQLYENAFFRGGDVASMYTPNAQYCQMRCTFHPRCLLFSFLPASSINDMEKRFGCFLKDSVTGTLPKVHRTGAVSGHSLKQCGHQISACHRDIYKGVDMRGVNFNVSKVSSVEECQKRCTNNIRCQFFSYATQTFHKAEYRNNCLLKYSPGGTPTAIKVLSNVESGFSLKPCALSEIGCHMNIFQHLAFSDVDVARVLTPDAFVCRTICTYHPNCLFFTFYTNVWKIESQRNVCLLKTSESGTPSSSTPQENTISGYSLLTCKRTLPEPCHSKIYPGVDFGGEELNVTFVKGVNVCQETCTKMIRCQFFTYSLLPEDCKEEKCKCFLRLSMDGSPTRIAYGTQGSSGYSLRLCNTGDNSVCTTKTSTRIVGGTNSSWGEWPWQVSLQVKLTAQRHLCGGSLIGHQWVLTAAHCFDGLPLQDVWRIYSGILNLSDITKDTPFSQIKEIIIHQNYKVSEGNHDIALIKLQAPLNYTEFQKPICLPSKGDTSTIYTNCWVTGWGFSKEKGEIQNILQKVNIPLVTNEECQKRYQDYKITQRMVCAGYKEGGKDACKGDSGGPLVCKHNGMWRLVGITSWGEGCARREQPGVYTKVAEYMDWILEKTQSSDGKAQMQSPAVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Pafah2 (NM_001285872) Mouse Tagged ORF Clone
MR229787 10 µg

Pafah2 (NM_001285872) Mouse Tagged ORF Clone

Ask
View Details
PCMV-Ptprc-3xFLAG-Neo Plasmid
PVT64366 2 µg

PCMV-Ptprc-3xFLAG-Neo Plasmid

Ask
View Details
Mouse Monoclonal ARL2BP Antibody (OTI1A10) [DyLight 405]
NBP2-71743V 0.1 mL

Mouse Monoclonal ARL2BP Antibody (OTI1A10) [DyLight 405]

Ask
View Details
Guinea pig DTX1 Deltex protein 1 ELISA Kit
MBS726272-01 48 Well

Guinea pig DTX1 Deltex protein 1 ELISA Kit

Ask
View Details
Guinea pig DTX1 Deltex protein 1 ELISA Kit
MBS726272-02 96 Well

Guinea pig DTX1 Deltex protein 1 ELISA Kit

Ask
View Details
Guinea pig DTX1 Deltex protein 1 ELISA Kit
MBS726272-03 5x 96 Well

Guinea pig DTX1 Deltex protein 1 ELISA Kit

Ask
View Details