Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Plasma Kallikrein/KLKB1 (C-6His)

Source: Human Cells. MW :70.2kD. Recombinant Human Plasma kallikrein is produced by our Mammalian expression system and the target gene encoding Gly20-Ala638 is expressed with a 6His tag at the C-terminus. KLKB1 is a 638 amino acids protein that belongs to the peptidase S1 family and plasma kallikrein subfamily. It contains a peptidase S1 domain and four apple domains. The enzyme cleaves Lys-Arg and Arg-Ser bonds. It activates, in a reciprocal reaction, factor XII after its binding to a negatively charged surface. It also releases bradykinin from HMW kininogen and may also play a role in the renin-angiotensin system by converting prorenin into renin. It participates in the surface-dependent activation of blood coagulation, fibrinolysis, kinin generation and inflammation.Plasma prekallikrein deficiency causes a prolonged activated partial thromboplastin time in patients.

Product Specifications

Gene Name

KLKB1

Gene ID

3818

UniProt

P03952

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl,150mM NaCl,10% Glycerol, pH8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

GCLTQLYENAFFRGGDVASMYTPNAQYCQMRCTFHPRCLLFSFLPASSINDMEKRFGCFLKDSVTGTLPKVHRTGAVSGHSLKQCGHQISACHRDIYKGVDMRGVNFNVSKVSSVEECQKRCTNNIRCQFFSYATQTFHKAEYRNNCLLKYSPGGTPTAIKVLSNVESGFSLKPCALSEIGCHMNIFQHLAFSDVDVARVLTPDAFVCRTICTYHPNCLFFTFYTNVWKIESQRNVCLLKTSESGTPSSSTPQENTISGYSLLTCKRTLPEPCHSKIYPGVDFGGEELNVTFVKGVNVCQETCTKMIRCQFFTYSLLPEDCKEEKCKCFLRLSMDGSPTRIAYGTQGSSGYSLRLCNTGDNSVCTTKTSTRIVGGTNSSWGEWPWQVSLQVKLTAQRHLCGGSLIGHQWVLTAAHCFDGLPLQDVWRIYSGILNLSDITKDTPFSQIKEIIIHQNYKVSEGNHDIALIKLQAPLNYTEFQKPICLPSKGDTSTIYTNCWVTGWGFSKEKGEIQNILQKVNIPLVTNEECQKRYQDYKITQRMVCAGYKEGGKDACKGDSGGPLVCKHNGMWRLVGITSWGEGCARREQPGVYTKVAEYMDWILEKTQSSDGKAQMQSPAVDHHHHHH
More Discoveries

Explore Other Products

Browse additional items from our catalog

MSY2 Polyclonal Antibody
JOT-AP05638-01 50ul

MSY2 Polyclonal Antibody

Sign In for Pricing
View Details
MSY2 Polyclonal Antibody
JOT-AP05638-02 100ul

MSY2 Polyclonal Antibody

Sign In for Pricing
View Details
Nucleobindin 2 (Biotin)
549033 200 µL

Nucleobindin 2 (Biotin)

Sign In for Pricing
View Details
Gm16509 3'UTR GFP Stable Cell Line
TU157758 1.0 mL

Gm16509 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
CD40 Mouse Monoclonal Antibody [Clone ID: LBI7H2]
AMM17852VCF 100 µg

CD40 Mouse Monoclonal Antibody [Clone ID: LBI7H2]

Sign In for Pricing
View Details
Carboxypeptidase B2 Protein, Rat, Recombinant (His)
MF-0135470-01 5 µg

Carboxypeptidase B2 Protein, Rat, Recombinant (His)

Sign In for Pricing
View Details