Recombinant Human Serpin Kazal-7/SPINK7/ECG2 (C-6His)
Source: Human Cells. MW :8.2kD. Recombinant Human SPINK7 is produced by our Mammalian expression system and the target gene encoding Ser20-Cys85 is expressed with a 6His tag at the C-terminus. Serine protease inhibitor Kazal-type 7 (SPINK7) is a secreted protein, that in humans is encoded by the SPINK7 gene. SPINK7 contains 1 Kazal-like domain. SPINK7 is probably serine protease inhibitor. Recombinant human SPINK7 is a single, non-glycosylated polypeptide chain containing 74 amino acids and fused to His-tag at c-terminus.
Product Specifications
Gene Name
SPINK7
Gene ID
84651
UniProt
P58062
Components
Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.
Shipping Conditions
The product is shipped on dry ice/ice packs.
Storage Conditions
Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
SEAASLSPKKVDCSIYKKYPVVAIPCPITYLPVCGSDYITYGNECHLCTESLKSNGRVQFLHDGSCVDHHHHHH
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
CD50 (ICAM-3) (101-1D2), CF568 conjugate, 0.1mg/mL
CD50 / ICAM3 (CG106), CF405S conjugate, 0.1mg/mL
