Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse L-Lactate Dehydrogenase/LDHA/LDH1 (C-6His)

Source: Human Cells. MW :37.5kD. Recombinant Mouse L-lactate dehydrogenase is produced by our Mammalian expression system and the target gene encoding Met1-Phe332 is expressed with a 6His tag at the C-terminus. Mouse Lactate dehydrogenase A (LDHA) is a member of the LDH/MDH superfamily and LDH family. LDHA catalyzes the inter-conversion of pyruvate and L-lactate with concomitant inter-conversion of NADH and NAD+. LDHA is found in most somatic tissues, though predominantly in muscle tissue and tumours. It has also been shown that LDHA plays an important role in the development, invasion and metastasis of malignancies. Mutations in LDHA have been linked to exertional myoglobinuria.

Product Specifications

Gene Name

Ldha

Gene ID

16828

UniProt

P06151

Components

Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MATLKDQLIVNLLKEEQAPQNKITVVGVGAVGMACAISILMKDLADELALVDVMEDKLKGEMMDLQHGSLFLKTPKIVSSKDYCVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNIVKYSPHCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHALSCHGWVLGEHGDSSVPVWSGVNVAGVSLKSLNPELGTDADKEQWKEVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGINEDVFLSVPCILGQNGISDVVKVTLTPEEEARLKKSADTLWGIQKELQFVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Dexras1 (RASD1) (NM_016084) Human Tagged ORF Clone Lentiviral Particle
RC205285L1V 200 µL

Dexras1 (RASD1) (NM_016084) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
TXNDC12 Polyclonal Antibody
MBS2555371-01 0.06 mL

TXNDC12 Polyclonal Antibody

Ask
View Details
TXNDC12 Polyclonal Antibody
MBS2555371-02 0.12 mL

TXNDC12 Polyclonal Antibody

Ask
View Details
TXNDC12 Polyclonal Antibody
MBS2555371-03 0.2 mL

TXNDC12 Polyclonal Antibody

Ask
View Details
TXNDC12 Polyclonal Antibody
MBS2555371-04 5x 0.2 mL

TXNDC12 Polyclonal Antibody

Ask
View Details
Valproic Acid (APC) discontinued
171806-APC 100 µL

Valproic Acid (APC) discontinued

Ask
View Details