Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Plasma Glutamate Carboxypeptidase/PGCP (C-6His)

Source: Human Cells. MW :50.9kD. Recombinant Mouse Plasma glutamate carboxypeptidase is produced by our Mammalian expression system and the target gene encoding Lys19-Ser470 is expressed with a 6His tag at the C-terminus. Carboxypeptidase Q (Cpq) is a member of the peptidase M28 family. PGCP is involved in a number of fundamental biological processes such as the hydrolysis of circulating peptides, catalyzing the hydrolysis of dipeptides with unsubstituted terminals into amino acids. Carboxypeptidase may play an important role in the liberation of thyroxine hormone from its thyroglobulin (Tg) precursor. The monomeric form is inactive while the homodimer is active.

Product Specifications

Gene Name

Cpq

Gene ID

54381

UniProt

Q9WVJ3

Components

Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

KAVFKNGVSQRTFREIKEEIANYEDVAKAIINLAVYGKYQNRSYERLGLLVDTVGPRLSGSKNLEKAIQIMYQNLQQDGLENVHLEQVRIPHWERGEESAVMLEPRIHKMAILGLGSSIGTPPGGITAEVLVVASFDELQRRASEARGKIIVYNQPYTGYEKTVQYRVQGAVEAAKVGAVASLIQSVASFSIYSPHTGIQKYQDGVPKIPTACITVEDAEMMSRMASRGNKIVIHLEMGAKTYPDTDSFNTVAEITGSMYPEEVVLVSGHLDSWDVGQGALDDGGGAFISWEALSLVKDLGLRPKRTLRLVLWTAEEQGGIGASQYYELHKANISKYSLVMEADSGTFLPTGLQFTGSDKARAIMKEVMNLLQPLNVTKVFSNGEGTDINFWIQAGVPGASLRDDLYKYFFFHHSHGDTMTVMDPKQMNVAAAVWAVVAYVVADMDEMLPRSVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rotenone
S2348-25mg 25 mg

Rotenone

Ask
View Details
Rabbit Polyclonal ARL15 Antibody
NBP2-92298-0.02mL 0.02 mL

Rabbit Polyclonal ARL15 Antibody

Ask
View Details
FLT3 Ligand protein
30R-2451 10 ug

FLT3 Ligand protein

Ask
View Details