Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Plasma Glutamate Carboxypeptidase/PGCP (C-6His)

Source: Human Cells. MW :50.9kD. Recombinant Mouse Plasma glutamate carboxypeptidase is produced by our Mammalian expression system and the target gene encoding Lys19-Ser470 is expressed with a 6His tag at the C-terminus. Carboxypeptidase Q (Cpq) is a member of the peptidase M28 family. PGCP is involved in a number of fundamental biological processes such as the hydrolysis of circulating peptides, catalyzing the hydrolysis of dipeptides with unsubstituted terminals into amino acids. Carboxypeptidase may play an important role in the liberation of thyroxine hormone from its thyroglobulin (Tg) precursor. The monomeric form is inactive while the homodimer is active.

Product Specifications

Gene Name

Cpq

Gene ID

54381

UniProt

Q9WVJ3

Components

Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

KAVFKNGVSQRTFREIKEEIANYEDVAKAIINLAVYGKYQNRSYERLGLLVDTVGPRLSGSKNLEKAIQIMYQNLQQDGLENVHLEQVRIPHWERGEESAVMLEPRIHKMAILGLGSSIGTPPGGITAEVLVVASFDELQRRASEARGKIIVYNQPYTGYEKTVQYRVQGAVEAAKVGAVASLIQSVASFSIYSPHTGIQKYQDGVPKIPTACITVEDAEMMSRMASRGNKIVIHLEMGAKTYPDTDSFNTVAEITGSMYPEEVVLVSGHLDSWDVGQGALDDGGGAFISWEALSLVKDLGLRPKRTLRLVLWTAEEQGGIGASQYYELHKANISKYSLVMEADSGTFLPTGLQFTGSDKARAIMKEVMNLLQPLNVTKVFSNGEGTDINFWIQAGVPGASLRDDLYKYFFFHHSHGDTMTVMDPKQMNVAAAVWAVVAYVVADMDEMLPRSVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal PAPOLA Antibody [Alexa Fluor 700]
NB100-55267AF700 0.1 mL

Rabbit Polyclonal PAPOLA Antibody [Alexa Fluor 700]

Ask
View Details
PRDM11 (G-12) Alexa Fluor® 488
sc-398876 AF488 200 µg/mL

PRDM11 (G-12) Alexa Fluor® 488

Ask
View Details
PP1C gamma (PPP1CC) Rabbit Polyclonal Antibody
TA362522 100 µL

PP1C gamma (PPP1CC) Rabbit Polyclonal Antibody

Ask
View Details
Oprm1 (NM_001038597) Rat Tagged Lenti ORF Clone
RR200404L4 10 µg

Oprm1 (NM_001038597) Rat Tagged Lenti ORF Clone

Ask
View Details
Lentiviral human FNDC4 sgRNA gene knockout kit - Lentiviral human FNDC4 sgRNA gene knockout kit (100)
GTR15364297 1 Vial

Lentiviral human FNDC4 sgRNA gene knockout kit - Lentiviral human FNDC4 sgRNA gene knockout kit (100)

Ask
View Details
GSG1L, CT (GSG1L, Germ cell-specific gene 1-like protein) (Biotin) discontinued
036329-Biotin 200 µL

GSG1L, CT (GSG1L, Germ cell-specific gene 1-like protein) (Biotin) discontinued

Ask
View Details